product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human AP-2 complex subunit mu protein
catalog :
MBS717078
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
product information
catalog number :
MBS717078
products type :
Recombinant Protein
products full name :
Recombinant Human AP-2 complex subunit mu protein
products short name :
AP-2 complex subunit mu
products name syn :
AP-2 mu chain; Adaptin-mu2; Adaptor protein complex AP-2 subunit mu; Adaptor-related protein complex 2 subunit mu; Clathrin assembly protein complex 2 mu medium chain; Clathrin coat assembly protein AP50; Clathrin coat-associated protein AP50; HA2 50 kDa subunit; Plasma membrane adaptor AP-2 50 kDa protein
other names :
AP-2 complex subunit mu isoform b; AP-2 complex subunit mu; AP-2 complex subunit mu; adaptor related protein complex 2 mu 1 subunit; AP-2 mu chain; Adaptin-mu2; Adaptor protein complex AP-2 subunit mu; Adaptor-related protein complex 2 subunit mu; Clathrin assembly protein complex 2 mu medium chain; Clathrin coat assembly protein AP50; Clathrin coat-associated protein AP50; HA2 50 kDa subunit; Plasma membrane adaptor AP-2 50 kDa protein
products gene name :
AP2M1
products gene name syn :
CLAPM1; KIAA0109
other gene names :
AP2M1; AP2M1; mu2; AP50; CLAPM1; CLAPM1; KIAA0109
uniprot entry name :
AP2M1_HUMAN
host :
E Coli
sequence positions :
1-435
sequence length :
433
sequence :
MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHA
RQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMV
FEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILD
FGYPQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVT
GQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAH
VSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETS
KSGKQSIAIDDCTFHQCVRLS
purity :
Greater than 90% as determined by SDS-PAGE.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Transport
products description :
Component of the adaptor protein complex 2 (AP-2). Adaptor protein complexes function in protein transport via transport vesicles in different membrane traffic pathways. Adaptor protein complexes are vesicle coat components and appear to be involved in cargo selection and vesicle formation. AP-2 is involved in clathrin-dependent endocytosis in which cargo proteins are incorporated into vesicles surrounded by clathrin (clathrin-coated vesicles, CCVs) which are destined for fusion with the early endosome. The clathrin lattice serves as a mechanical scaffold but is itself unable to bind directly to membrane components. Clathrin-associated adaptor protein (AP) complexes which can bind directly to both the clathrin lattice and to the lipid and protein components of membranes are considered to be the major clathrin adaptors contributing the CCV formation. AP-2 also serves as a cargo receptor to selectively sort the membrane proteins involved in receptor-mediated endocytosis. AP-2 ses to play a role in the recycling of synaptic vesicle membranes from the presynaptic surface. AP-2 recognizes Y-X-X-[FILMV] (Y-X-X-Phi) and [ED]-X-X-X-L-[LI] endocytosis signal motifs within the cytosolic tails of transmembrane cargo molecules. AP-2 may also play a role in maintaining normal post-endocytic trafficking through the ARF6-regulated, non-clathrin pathway. The AP-2 mu subunit binds to transmembrane cargo proteins; it recognizes the Y-X-X-Phi motifs. The surface region interacting with to the Y-X-X-Phi motif is inaccessible in cytosolic AP-2, but becomes accessible through a conformational change following phosphorylation of AP-2 mu subunit at 'Tyr-156' in membrane-associated AP-2. The membrane-specific phosphorylation event appears to involve assbled clathrin which activates the AP-2 mu kinase AAK1. Plays a role in endocytosis of frizzled family members upon Wnt signaling.
products references :
Molecular cloning and sequence analysis of the cDNA for human 50 kDa subunit of the clathrin assembly complex AP-2 (AP50)
ncbi gi num :
68799814
ncbi acc num :
NP_001020376.1
ncbi gb acc num :
NM_001025205.1
uniprot acc num :
Q96CW1
ncbi mol weight :
77kD
ncbi pathways :
Adaptive Immune System Pathway (1269171); Arf1 Pathway (137927); Axon Guidance Pathway (1270303); Beta-catenin Independent WNT Signaling Pathway (1269610); Developmental Biology Pathway (1270302); Disease Pathway (1268854); EGFR Downregulation Pathway (1269385); EPH-Ephrin Signaling Pathway (1270330); EPH-ephrin Mediated Repulsion Of Cells Pathway (1270334); Endocrine And Other Factor-regulated Calcium Reabsorption Pathway (213307)
ncbi summary :
This gene encodes a subunit of the heterotetrameric coat assembly protein complex 2 (AP2), which belongs to the adaptor complexes medium subunits family. The encoded protein is required for the activity of a vacuolar ATPase, which is responsible for proton pumping occurring in the acidification of endosomes and lysosomes. The encoded protein may also play an important role in regulating the intracellular trafficking and function of CTLA-4 protein. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2015]
uniprot summary :
AP2M1: a protein of the adaptor complexes medium subunit family. A subunit of the heterotetrameric coat assembly protein complex 2 (AP2) which links clathrin to receptors in coated vesicles. Interacts with the cytoplasmic tails of membrane proteins and polyphosphoinositide-containing lipids. Is not required for clathrin-coated vesicle formation at the plasma membrane, but that it is one of several endocytic adaptors required for the uptake of certain cargo proteins. Is required for the activity of a vacuolar ATPase, which is responsible for proton pumping occurring in the acidification of endosomes and lysosomes. AP-2 is a heterotetramer composed of two large chains (alpha and beta), a medium chain (AP50) and a small chain (AP17). Protein type: Adaptor/scaffold; Vesicle. Chromosomal Location of Human Ortholog: 3q28. Cellular Component: AP-2 adaptor complex; cytosol; lysosomal membrane; mitochondrion; plasma membrane; terminal button. Molecular Function: lipid binding; low-density lipoprotein receptor binding; protein binding; signal sequence binding; transporter activity. Biological Process: antigen processing and presentation of exogenous peptide antigen via MHC class II; axon guidance; ephrin receptor signaling pathway; epidermal growth factor receptor signaling pathway; intracellular protein transport; negative regulation of epidermal growth factor receptor signaling pathway; nerve growth factor receptor signaling pathway; regulation of defense response to virus by virus; synaptic transmission; viral reproduction
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
1 mg (E-Coli)
price4 :
1180
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!