product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant human DnaJ homolog subfamily B member 1 protein
catalog :
MBS717051
quantity :
0.05 mg
price :
195 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS717051
products type :
Recombinant Protein
products full name :
Recombinant human DnaJ homolog subfamily B member 1 protein
products short name :
DnaJ homolog subfamily B member 1 protein
products name syn :
Recombinant human DnaJ homolog subfamily B member 1 protein
other names :
dnaJ homolog subfamily B member 1; DnaJ homolog subfamily B member 1; dnaJ homolog subfamily B member 1; hDj-1; human DnaJ protein 1; heat shock protein 40; dnaJ protein homolog 1; heat shock 40kD protein 1; radial spoke 16 homolog B; heat shock 40 kDa protein 1; DnaJ (Hsp40) homolog, subfmaily B, member 1; DnaJ (Hsp40) homolog, subfamily B, member 1; DnaJ protein homolog 1; Heat shock 40 kDa protein 1; HSP40; Heat shock protein 40; Human DnaJ protein 1
other gene names :
DNAJB1; DNAJB1; Hdj1; Sis1; HSPF1; Hsp40; RSPH16B; DNAJ1; HDJ1; HSPF1; HSP40; Heat shock protein 40; hDj-1
uniprot entry name :
DNJB1_HUMAN
host :
E Coli
sequence :
MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEP
GAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPS
GGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFG
QRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPA
RKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGK
SIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPAD
IVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNV
PTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRG
DLIIEFEVIFPERIPQTSRTVLEQVLPI
purity :
0.95
storage stability :
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.
other info1 :
Tag Information: GST tagged
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
products description :
Function Interacts with HSP70 and can stimulate its ATPase activity. Stimulates the association between HSC70 and HIP.
products references :
[1] "The cellular inhibitor of the PKR protein kinase, P58(IPK), is an influenza virus-activated co-chaperone that modulates heat shock protein 70 activity.
ncbi gi num :
5453690
ncbi acc num :
NP_006136.1
ncbi gb acc num :
NM_006145.1
uniprot acc num :
P25685
ncbi mol weight :
64 KD
ncbi pathways :
Influenza A Pathway 217173!!Influenza A Pathway 217150!!Protein Processing In Endoplasmic Reticulum Pathway 167325!!Protein Processing In Endoplasmic Reticulum Pathway 167190
uniprot summary :
Function: Interacts with HSP70 and can stimulate its ATPase activity. Stimulates the association between HSC70 and HIP. Subunit structure: Interacts with DNAJC3. Interacts with SRPK1. Ref.6 Ref.7. Subcellular location: Cytoplasm. Nucleus. Nucleus nucleolus. Note: Translocates rapidly from the cytoplasm to the nucleus, and especially to the nucleoli, upon heat shock. Ref.5. Induction: By heat shock. Ref.5. Sequence similarities: Contains 1 J domain. Sequence caution: The sequence CAA44287.1 differs from that shown. Reason: Frameshift at positions 11, 28, 81 and 136.
size :
0.05 mg
price :
195 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!