catalog number :
MBS7110874
products type :
Recombinant Protein
products full name :
Recombinant Human L-lactate dehydrogenase A chain (LDHA), partial
products short name :
[L-lactate dehydrogenase A chain (LDHA)]
products name syn :
[Cell proliferation-inducing gene 19 protein; LDH muscle subunit]
other names :
[L-lactate dehydrogenase A chain isoform 2; L-lactate dehydrogenase A chain; L-lactate dehydrogenase A chain; lactate dehydrogenase A; Cell proliferation-inducing gene 19 protein; LDH muscle subunit; LDH-M; Renal carcinoma antigen NY-REN-59]
products gene name :
[LDHA]
other gene names :
[LDHA; LDHA; LDHM; GSD11; PIG19; HEL-S-133P; LDH-A; LDH-M]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[5-323. Partial]
sequence :
KDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKD
LADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKD
YNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFII
PNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIG
SGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVP
VWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESA
YEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMI
KGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARL
KKSADTL
purity :
Greater than 85% as determined by SDS-PAGE.
storage stability :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
image1 heading :
SDS-Page
other info1 :
Organism: Homo sapiens (Human). Tag Information: NO-tagged. Storage Buffer: Tris-based buffer, 50% glycerol
other info2 :
Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products categories :
Metabolism
products references :
Genotypic analysis of families with lactate dehydrogenase A (M) deficiency by selective DNA amplification." Maekawa M., Sudo K., Li S.S., Kanno T.Hum. Genet. 88:34-38 (1991)
ncbi acc num :
NP_001128711.1
ncbi gb acc num :
NM_001135239.1
ncbi mol weight :
35.1 kDa
ncbi pathways :
Cysteine And Methionine Metabolism Pathway (104488); Cysteine And Methionine Metabolism Pathway (103421); Glycolysis / Gluconeogenesis Pathway (82926); Glycolysis / Gluconeogenesis Pathway (287); Glycolysis And Gluconeogenesis Pathway (198814); HIF-1 Signaling Pathway (695200); HIF-1-alpha Transcription Factor Network Pathway (138045); Metabolism Pathway (477135); Propanoate Metabolism Pathway (83004); Propanoate Metabolism Pathway (387)
ncbi summary :
The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene. [provided by RefSeq, Sep 2008]