product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Zinc transporter 8 (SLC30A8), partial
catalog :
MBS7093734
quantity :
0.05 mg (E-Coli)
price :
495 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS7093734
products type :
Recombinant Protein
products full name :
Recombinant Human Zinc transporter 8 (SLC30A8), partial
products short name :
[Zinc transporter 8 (SLC30A8)]
other names :
[zinc transporter 8 isoform b; Zinc transporter 8; zinc transporter 8; solute carrier family 30 member 8; Solute carrier family 30 member 8]
products gene name :
[SLC30A8]
products gene name syn :
[SLC30A8]
other gene names :
[SLC30A8; SLC30A8; ZNT8; ZnT-8; ZNT8; ZnT-8]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[267–369. Partial]
sequence :
LKDFSILLMEGVPKSLNYSGVKELILAVDGVLSVHSLHI
WSLTMNQVILSAHVATAASRDSQVVRREIAKALSKSFTM
HSLTIQMESPVDQDPDCLFCEDPCD
purity :
>85% (SDS-PAGE)
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Homo sapiens (Human)
other info2 :
Storage Buffer: Tris-based buffer, 50% glycerol
ncbi gi num :
289803003
ncbi acc num :
NP_001166282.1
ncbi gb acc num :
NM_001172811.1
uniprot acc num :
Q8IWU4
ncbi mol weight :
35,053 Da
ncbi pathways :
Insulin Processing Pathway (1268747); Metabolism Of Proteins Pathway (1268677); Metal Ion SLC Transporters Pathway (1269930); Peptide Hormone Metabolism Pathway (1268746); SLC-mediated Transmembrane Transport Pathway (1269907); Transmembrane Transport Of Small Molecules Pathway (1269903); Transport Of Glucose And Other Sugars, Bile Salts And Organic Acids, Metal Ions And Amine Compounds Pathway (1269923); Zinc Efflux And Compartmentalization By The SLC30 Family Pathway (1269932); Zinc Homeostasis Pathway (1458250); Zinc Transporters Pathway (1269931)
ncbi summary :
The protein encoded by this gene is a zinc efflux transporter involved in the accumulation of zinc in intracellular vesicles. This gene is expressed at a high level only in the pancreas, particularly in islets of Langerhans. The encoded protein colocalizes with insulin in the secretory pathway granules of the insulin-secreting INS-1 cells. Allelic variants of this gene exist that confer susceptibility to diabetes mellitus, noninsulin-dependent (NIDDM). Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Mar 2010]
uniprot summary :
Facilitates the accumulation of zinc from the cytoplasm into intracellular vesicles, being a zinc-efflux transporter. May be a major component for providing zinc to insulin maturation and/or storage processes in insulin-secreting pancreatic beta-cells.
size1 :
0.05 mg (E-Coli)
price1 :
495 USD
size2 :
0.2 mg (E-Coli)
price2 :
660
size3 :
0.05 mg (Yeast)
price3 :
665
size4 :
0.5 mg (E-Coli)
price4 :
725
size5 :
0.05 mg (Baculovirus)
price5 :
885
size6 :
0.2 mg (Yeast)
price6 :
900
size7 :
0.5 mg (Yeast)
price7 :
1010
size8 :
1 mg (E-Coli)
price8 :
1090
size9 :
0.05 mg (Mammalian-Cell)
price9 :
1120
size10 :
0.1 mg (Baculovirus)
price10 :
1265
size11 :
1 mg (Yeast)
price11 :
1590
size12 :
0.5 mg (Baculovirus)
price12 :
1665
size13 :
0.1 mg (Mammalian-Cell)
price13 :
1835
size14 :
1 mg (Baculovirus)
price14 :
2600
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!