ENKAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVI
VPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTL
SAYAELVISPSERSDKGIYTLKLENRVKTISGEIDVNVI
ARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVV
EKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCA
RNKCGPGEPAYVDEPVNMSTPATVPDPPENVKWRDRTAN
SIFLTWDPPKNDGG

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Human Three prime repair exonuclease 1 (TREX1), partial | MBS7053496
- Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP c ...
- Recombinant Human Dihydropyrimidinase-related protein 1 (CRMP1) | MBS7074427
- Recombinant Escherichia coli Heat-stable enterotoxin A2(sta2) | MBS7079792
- Recombinant Crimean-Congo hemorrhagic fever virus Envelope glycoprotein (GP), pa ...