product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Myelin proteolipid protein (Plp1)
catalog :
MBS7026293
quantity :
0.01 mg
price :
905 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS7026293
products type :
Recombinant Protein
products full name :
Recombinant Mouse Myelin proteolipid protein (Plp1)
products short name :
[Myelin proteolipid protein (Plp1)]
other names :
[myelin proteolipid protein isoform 2; Myelin proteolipid protein; myelin proteolipid protein; proteolipid protein (myelin) 1; Lipophilin]
products gene name :
[Plp1]
products gene name syn :
[Plp]
other gene names :
[Plp1; Plp1; jp; Plp; msd; rsh; DM20; jimpy; Plp; PLP]
uniprot entry name :
MYPR_MOUSE
host :
Cell Free Expression
sequence positions :
[2-277. Full Length of Mature Protein]
sequence :
GLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEAL
TGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFF
FLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVT
GGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITY
ALTVVWLLVFACSAVPVYIYFNTWTTCQSIAFPSKTSAS
IGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQM
TFHLFIAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRG
TKF
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
app notes :
This is a recombinant transmembrane protein expressed in a cell-free expression system.
other info1 :
Species: Mouse. Storage Buffer: Tris-based buffer, 50% glycerol.
products categories :
Transmembrane Protein
ncbi gi num :
594542470
ncbi acc num :
NP_001277490.1
ncbi gb acc num :
NM_001290561.1
uniprot acc num :
P60202
ncbi mol weight :
26,274 Da
uniprot summary :
PLP1: This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin. Defects in PLP1 are the cause of leukodystrophy hypomyelinating type 1 (HLD1); also known as Pelizaeus-Merzbacher disease. HLD1 is an X-linked recessive dysmyelinating disorder of the central nervous system in which myelin is not formed properly. It is characterized clinically by nystagmus, spastic quadriplegia, ataxia, and developmental delay. Defects in PLP1 are the cause of spastic paraplegia X- linked type 2 (SPG2). SPG2 is characterized by spastic gait and hyperreflexia. In some patients, complicating features include nystagmus, dysarthria, sensory disturbance, mental retardation, optic atrophy. Belongs to the myelin proteolipid protein family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, multi-pass; Cell surface; Membrane protein, integral. Cellular Component: integral to membrane; membrane; myelin sheath; plasma membrane. Molecular Function: protein binding; structural constituent of myelin sheath; structural molecule activity. Biological Process: astrocyte development; axon ensheathment; cell maturation; glial cell differentiation; inflammatory response; integrin-mediated signaling pathway; long-chain fatty acid biosynthetic process; myelination; myelination in the central nervous system
size1 :
0.01 mg
price1 :
905 USD
size2 :
0.05 mg
price2 :
1405
size3 :
0.1 mg
price3 :
2330
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!