product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human P2Y purinoceptor 12 (P2RY12)
catalog :
MBS7025273
quantity :
0.01 mg
price :
505 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS7025273
products type :
Recombinant Protein
products full name :
Recombinant Human P2Y purinoceptor 12 (P2RY12)
products short name :
[P2Y purinoceptor 12 (P2RY12)]
other names :
[P2Y purinoceptor 12; P2Y purinoceptor 12; P2Y purinoceptor 12; purinergic receptor P2Y12; ADP-glucose receptor; ADPG-R; P2T(AC); P2Y(AC); P2Y(cyc); P2Y12 platelet ADP receptor; P2Y(ADP); SP1999]
products gene name :
[P2RY12]
products gene name syn :
[HORK3]
other gene names :
[P2RY12; P2RY12; HORK3; P2Y12; ADPG-R; BDPLT8; SP1999; P2T(AC); P2Y(AC); P2Y(12)R; P2Y(ADP); P2Y(cyc); HORK3; P2Y12; ADPG-R; P2Y(ADP)]
uniprot entry name :
P2Y12_HUMAN
host :
Cell Free Expression
sequence positions :
[1-342. Full Length]
sequence :
MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVG
LITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFP
FKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGL
ITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLS
LPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQ
VIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKV
NVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAE
NTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISM
LKCPNSATSLSQDNRKKEQDGGDPNEETPM
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
app notes :
This is a recombinant transmembrane protein expressed in a cell-free expression system.
other info1 :
Species: Human. Storage Buffer: Tris-based buffer, 50% glycerol.
products categories :
Transmembrane Protein
ncbi gi num :
12232483
ncbi acc num :
NP_073625.1
ncbi gb acc num :
NM_022788.4
uniprot acc num :
Q9H244
ncbi mol weight :
39,439 Da
ncbi pathways :
ADP Signalling Through P2Y Purinoceptor 12 Pathway (1269353); Class A/1 (Rhodopsin-like Receptors) Pathway (1269545); G Alpha (i) Signalling Events Pathway (1269576); GPCR Downstream Signaling Pathway (1269574); GPCR Ligand Binding Pathway (1269544); GPCRs, Class A Rhodopsin-like Pathway (198886); Hemostasis Pathway (1269340); Nucleotide-like (purinergic) Receptors Pathway (1269563); P2Y Receptors Pathway (1269564); Platelet Activation Pathway (952858)
ncbi summary :
The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is involved in platelet aggregation, and is a potential target for the treatment of thromboembolisms and other clotting disorders. Mutations in this gene are implicated in bleeding disorder, platelet type 8 (BDPLT8). Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jul 2013]
uniprot summary :
P2Y12: Receptor for ADP and ATP coupled to G-proteins that inhibit the adenylyl cyclase second messenger system. Not activated by UDP and UTP. Involved in platelets aggregation. Defects in P2RY12 are the cause of bleeding disorder platelet-type 8 (BDPLT8). A condition characterized by mild to moderate mucocutaneous bleeding, and excessive bleeding after surgery or trauma. The defect is due to severe impairment of platelet response to ADP resulting in defective platelet aggregation. Belongs to the G-protein coupled receptor 1 family. Protein type: Membrane protein, multi-pass; GPCR, family 1; Membrane protein, integral; Mitochondrial; Receptor, GPCR. Chromosomal Location of Human Ortholog: 3q25.1. Cellular Component: basal plasma membrane; caveola; cell surface; external side of plasma membrane; integral to plasma membrane; intrinsic to membrane; mitochondrion; plasma membrane. Molecular Function: adenosine receptor activity, G-protein coupled; guanyl-nucleotide exchange factor activity; platelet ADP receptor activity. Biological Process: adenosine receptor signaling pathway; G-protein coupled receptor protein signaling pathway; G-protein signaling, adenylate cyclase inhibiting pathway; glial cell migration; hemostasis; negative regulation of cell differentiation; positive regulation of GTPase activity; positive regulation of ion transport; protein kinase B signaling cascade; regulation of calcium ion transport; substrate-bound cell migration, cell extension. Disease: Bleeding Disorder, Platelet-type, 8
size1 :
0.01 mg
price1 :
505 USD
size2 :
0.05 mg
price2 :
755
size3 :
0.1 mg
price3 :
1215
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!