product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Potassium channel subfamily K member 1 (KCNK1)
catalog :
MBS7017724
quantity :
0.01 mg
price :
975 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS7017724
products type :
Recombinant Protein
products full name :
Recombinant Human Potassium channel subfamily K member 1 (KCNK1)
products short name :
[Potassium channel subfamily K member 1 (KCNK1)]
other names :
[potassium channel subfamily K member 1; Potassium channel subfamily K member 1; potassium channel subfamily K member 1; potassium two pore domain channel subfamily K member 1; Inward rectifying potassium channel protein TWIK-1]
products gene name :
[KCNK1]
products gene name syn :
[HOHO1; KCNO1; TWIK1]
other gene names :
[KCNK1; KCNK1; DPK; HOHO; K2P1; KCNO1; TWIK1; K2p1.1; TWIK-1; ]
uniprot entry name :
KCNK1_HUMAN
host :
Cell Free Expression
sequence positions :
[1-336aa; Full length protein]
sequence length :
336
sequence :
RRFLEEHECLSEQQLEQFLGRVLEASNYGVSVLSNASGNWNWDFTSALFFASTVLSTTGY GHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRITVHVTRRPVLYFHIRWGFSKQVVA IVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQK FRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLS FSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH
MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAV
VFSSVELPYEDLLRQELRKLK
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
app notes :
This is a recombinant transmembrane protein expressed in a cell-free expression system.
other info1 :
Species: Human. Storage Buffer: Tris-based buffer, 50% glycerol.
products categories :
Transmembrane Protein
ncbi gi num :
4504847
ncbi acc num :
NP_002236.1
ncbi gb acc num :
NM_002245.3
uniprot acc num :
O00180
ncbi mol weight :
38,143 Da
ncbi pathways :
Cardiac Conduction Pathway (1339115); Muscle Contraction Pathway (1269868); Neuronal System Pathway (1268763); Phase 4 - Resting Membrane Potential Pathway (1339116); Potassium Channels Pathway (1268821); Tandem Of Pore Domain In A Weak Inwardly Rectifying K+ Channels (TWIK) Pathway (1268832); Tandem Pore Domain Potassium Channels Pathway (1268831)
ncbi summary :
This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity. [provided by RefSeq, Jul 2008]
uniprot summary :
KCNK1: Weakly inward rectifying potassium channel. Homodimer (Potential). Widely expressed with high levels in heart and brain and lower levels in placenta, lung, liver and kidney. Belongs to the two pore domain potassium channel (TC 1.A.1.8) family. Protein type: Membrane protein, multi-pass; Membrane protein, integral. Chromosomal Location of Human Ortholog: 1q42-q43. Cellular Component: apical plasma membrane; brush border membrane; cell junction; cytoplasmic membrane-bound vesicle; dendrite; integral to membrane; integral to plasma membrane; perikaryon; plasma membrane; recycling endosome; synapse; voltage-gated potassium channel complex. Molecular Function: inward rectifier potassium channel activity; potassium channel activity; potassium ion leak channel activity; sodium channel activity; voltage-gated potassium channel activity. Biological Process: potassium ion transport; regulation of resting membrane potential; response to nicotine; stabilization of membrane potential
size1 :
0.01 mg
price1 :
975 USD
size2 :
0.05 mg
price2 :
1470
size3 :
0.1 mg
price3 :
2395
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!