catalog number :
MBS692287
products type :
Recombinant Protein
products full name :
Recombinant Human Soluble FGFR-2(IIIb)Fc Chimera
products short name :
[FGFR-2(IIIb)/Fc Chimera]
products name syn :
[Fibroblast growth factor receptor 2, BFR-1, FGFR2IIIb, KGFR]
other names :
[fibroblast growth factor receptor 2 isoform 1; Fibroblast growth factor receptor 2; fibroblast growth factor receptor 2; fibroblast growth factor receptor 2; K-sam; KGFR; Keratinocyte growth factor receptor; CD_antigen: CD332]
products gene name :
[FGFR-2]
other gene names :
[FGFR2; FGFR2; BEK; JWS; BBDS; CEK3; CFD1; ECT1; KGFR; TK14; TK25; BFR-1; CD332; K-SAM; BEK; KGFR; KSAM; FGFR-2; KGFR]
uniprot entry name :
FGFR2_HUMAN
sequence :
RPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEV
RCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATP
RDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTD
GAEDFVSENSNKRAPYWTNTEKMEKRLHAVPAANTVKFR
CPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLI
MESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRP
ILQAGLPANASTVVGGDVEFCKVYSDAQPHIQWIKHVEK
NGSKYGPDGLPYLKVLKHSGINSSNAEVLALFNVTEADA
GEYICKVSNYIGQANQSAWLTVLPKQQAPGREKEITASP
DYLEDPRRASIEGRGDPEEPKSCDKTHTCPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFN
WYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN
GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS
RELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT
PPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH
NHYTQKSLSLSPGK
purity :
> 90% by SDS-PAGE & silver stain
storage stability :
Lyophilized samples are stable for greater than six months at –20 degree C to –70 degree C. Reconstituted sFGFR-2(IIIb)/Fc should be stored in working aliquots at -20 degree C.
image1 heading :
SDS-PAGE
image2 heading :
Testing Data
image3 heading :
Testing Data
other info2 :
Buffer: PBS. Stabilizer: None. Reconstitution: The lyophilized sFGFR-2(IIIb)/Fc is soluble in water and most aqueous buffers and should be reconstituted to a concentration not lower than 50?g/ml. Biological Activity: (1) The activity of sFGFR-2(IIIb)/Fc was determined by its ability to inhibit the FGF10-induced proliferation of 4MBr-5 cells. (2) Measured by its binding ability in a functional ELISA. Recombinant human soluble FGFR-2(IIIb)/Fc Chimera bind to immobilized recombinant human FGF-10 (MBS692030).
products categories :
Recombinant Protein; Soluble Receptors; FGFR-2(IIIb)/Fc Chimera, soluble
products description :
Background: Recombinant human soluble FGFR-2 (IIIb) was fused via a Xa cleavage site with the Fc part of human IgG1. Human recombinant soluble FGFR-2 (IIIb) is a disulfide-linked homodimeric protein. In the reduced form the glycosylated subunits of sFGFR-2 (IIIb)/human Fc chimera display a molecular mass of about 90 kDa. Fibroblast Growth Factors (FGFs) comprise a family of at least eighteen structurally related proteins that are involved in a multitude of physiological and pathological cellular processes, including cell growth, differentiation, angiogenesis, wound healing and tumorigenesis. The biological activities of the FGFs are mediated by a family of type I transmembrane tyrosine kinases which undergo dimerization and autophosphorylation after ligand binding. Four distinct genes encoding closely related FGF receptors, FGFR-1 to -4 are known. Multiple forms of FGFR-1 to -3 are generated by alternative splicing of the mRNAs. A frequent splicing event involving FGFR-1 and -2 results in receptors containing all three Ig domains, referred to as the alpha isoform, or only IgII and IgIII, referred to as the ß isoform. Only the alpha isoform has been identified for FGFR-3 and FGFR-4.
Additional splicing events for FGFR-1 to -3, involving the C-terminal half of the IgIII domain encoded by two mutually exclusive alternative exons, generate FGF receptors with alternative IgIII domains (IIIb and IIIc). A IIIa isoform which is a secreted FGF binding protein containing only the N-terminal half of the IgIII domain plus some intron sequences has also been reported for FGFR-1. Mutations in FGFR-1 to -3 have been found in patients with birth defects involving craniosynostosis.
ncbi acc num :
NP_075259.4
ncbi gb acc num :
NM_000141.4
ncbi mol weight :
~90 kDa
ncbi pathways :
ARMS-mediated Activation Pathway (1269471); Activated Point Mutants Of FGFR2 Pathway (1268871); Adaptive Immune System Pathway (1269171); Angiogenesis Pathway (198772); Axon Guidance Pathway (1270303); Central Carbon Metabolism In Cancer Pathway (1059538); Central Carbon Metabolism In Cancer Pathway (1084231); Constitutive Signaling By Aberrant PI3K In Cancer Pathway (1268880); Cytokine Signaling In Immune System Pathway (1269310); DAP12 Interactions Pathway (1269283)
uniprot summary :
FGFR2 iso3: a receptor tyrosine kinase of the highly-conserved FGFR family that binds fibroblast growth factor (FGF). Mutations are associated with many craniosynostotic syndromes and bone malformations. Mutations cause syndromes with defects in facial and limb development, including Crouzon syndrome, Beare-Stevenson cutis gyrata syndrome, Pfeiffer syndrome, Apert syndrome, and Jackson-Weiss syndrome. Somatic mutations seen in gastric cancer. Amplified in gastric, breast and some B cell cancers, but deleted in glioblastoma Twenty splice-variant isoforms have been described. Protein type: EC 2.7.10.1; Kinase, protein; Membrane protein, integral; Oncoprotein; Protein kinase, TK; Protein kinase, tyrosine (receptor). Cellular Component: cell cortex; cell surface; cytoplasm; excitatory synapse; extracellular matrix; integral to plasma membrane; intracellular membrane-bound organelle; nucleoplasm; nucleus; plasma membrane. Molecular Function: 1-phosphatidylinositol-3-kinase activity; fibroblast growth factor binding; fibroblast growth factor receptor activity; phosphatidylinositol-4,5-bisphosphate 3-kinase activity; protein binding; protein homodimerization activity; protein-tyrosine kinase activity; Ras guanyl-nucleotide exchange factor activity. Biological Process: alveolus development; angiogenesis; axonogenesis; bone mineralization; branching morphogenesis of a nerve; cell fate commitment; cell-cell signaling; embryonic cranial skeleton morphogenesis; embryonic digestive tract morphogenesis; embryonic organ development; embryonic organ morphogenesis; embryonic pattern specification; epidermis morphogenesis; epithelial cell differentiation; fibroblast growth factor receptor signaling pathway; gland morphogenesis; gut development; hair follicle morphogenesis; in utero embryonic development; inner ear morphogenesis; lacrimal gland development; limb bud formation; lung development; MAPKKK cascade; mesenchymal cell differentiation; midbrain development; morphogenesis of embryonic epithelium; multicellular organism growth; negative regulation of transcription from RNA polymerase II promoter; neuroblast division in the ventricular zone; odontogenesis; orbitofrontal cortex development; organ growth; organ morphogenesis; otic vesicle formation; peptidyl-tyrosine phosphorylation; phosphoinositide-mediated signaling; positive regulation of cardiac muscle cell proliferation; positive regulation of cell cycle; positive regulation of cell division; positive regulation of cell proliferation; positive regulation of epithelial cell proliferation; positive regulation of MAPKKK cascade; positive regulation of mesenchymal cell proliferation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of Wnt receptor signaling pathway; post-embryonic development; protein amino acid autophosphorylation; pyramidal neuron development; regulation of cell fate commitment; regulation of fibroblast growth factor receptor signaling pathway; regulation of multicellular organism growth; regulation of osteoblast differentiation; regulation of osteoblast proliferation; regulation of phosphoinositide 3-kinase cascade; regulation of smooth muscle cell differentiation; regulation of smoothened signaling pathway; reproductive structure development; skeletal morphogenesis; ureteric bud development; ventricular cardiac muscle morphogenesis