Recombinant Human Vascular Endothelial Growth Factor 206 | MyBioSource MBS692231 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Vascular Endothelial Growth Factor 206

catalog :

MBS692231

quantity :

0.02 mg

price :

660 USD

more info or order :

MyBioSource product webpage

image

image 1 :

SDS-PAGE analysis of recombinant human VEGF 206 produced in E. coli. Sample was loaded under reducing conditions in 15% SDS polyacrylamide gel and stained with Coomassie blue.

image 2 :

VEGF 206 -induced proliferation of primary human dermal lymphatic endothelial cells (HDLEC). HDLECs were stimulated with increasing amounts of human VEGF 206 .

product information

catalog number :

MBS692231

products type :

Recombinant Protein

products full name :

Recombinant Human Vascular Endothelial Growth Factor 206

products short name :

[VEGF206]

products name syn :

[VEGF-A, VPF]

other names :

[vascular endothelial growth factor A isoform a; Vascular endothelial growth factor A; vascular endothelial growth factor A; vascular permeability factor; vascular endothelial growth factor A; Vascular permeability factor; VPF]

products gene name :

[VEGF206]

other gene names :

[VEGFA; VEGFA; VPF; VEGF; MVCD1; VEGF; VEGF-A; VPF]

uniprot entry name :

VEGFA_HUMAN

host :

E.coli

sequence :

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEY
PDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITM
QIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKS
VRGKGKGQKRRKKSRYKSWSVYVGARCCLMPWSLPGPHP
CGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNE
RTCRCDKPRR

purity :

> 75% by SDS-PAGE & Coomassie stain

form :

Lyophilized; 50 mM acetic acid

storage stability :

The lyophilized protein is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted VEGF 206 should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles.

image1 heading :

SDS-PAGE

image2 heading :

VEGF

other info1 :

Stabilizer: None. Length (aa): 206. Result by N-terminal sequencing: APMAEGG. Reconstitution: Centrifuge the vial prior to opening! The lyophilized VEGF 206 should be reconstituted in 50mM acetic acid to a concentration not lower than 50 ug/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin. Biological Activity: The ED 50 for stimulation of cell proliferation in human dermal lymphatic endothelial cells (HDLEC) by VEGF 206 has been determined to be in the range of 5-15 ng/ml.

products categories :

Recombinant protein; Cytokines & Growth Factors; VEGF206

products description :

Vascular endothelial growth factor-A (VEGF-A) mRNA undergoes alternative splicing events that generate several different homodimeric isoforms, e.g. VEGF 121 , VEGF 145 , VEGF 165 , VEGF 189 , and VEGF 206 . VEGF 121 is a non-heparin-binding acidic protein, which is freely diffusible. The longer forms, VEGF 189 or VEGF 206 , are highly basic proteins tightly bound to extracellular heparin-containing proteoglycans. VEGF 165 has intermediate properties. VEGF 165 was observed largely in Golgi apparatus-like structures. Immunogold labeling of cells expressing VEGF 189 or VEGF 206 revealed that the staining was localized to the subepithelial ECM. VEGF associated with the ECM was bioactive, because endothelial cells cultured on ECM derived from cells expressing VEGF 189 or VEGF 206 were markedly stimulated to proliferate. In addition, ECM-bound VEGF can be released into a soluble and bioactive form by heparin or plasmin. ECM-bound VEGF 189 and VEGF 206 have molecular masses consistent with the intact polypeptides. The ECM may represent an important source of VEGF and angiogenic potential. The isoforms VEGF 145 , VEGF 165 and VEGF 189 bind to heparin with high affinity, the affinity of VEGF 206 is much weaker. All dimeric forms have similar biological activities but their bio-availability is very different. However so far there are only a few data about the biological activities of VEGF 206

ncbi gi num :

76781480

ncbi acc num :

NP_001165095

ncbi gb acc num :

NM_001171624

uniprot acc num :

P15692-1

ncbi mol weight :

~47 kDa (Dimer)

ncbi pathways :

Angiogenesis Pathway (198772); Axon Guidance Pathway (105688); Bladder Cancer Pathway (83115); Bladder Cancer Pathway (527); Cellular Response To Hypoxia Pathway (645259); Cellular Responses To Stress Pathway (645258); Cytokine-cytokine Receptor Interaction Pathway (83051); Cytokine-cytokine Receptor Interaction Pathway (460); Developmental Biology Pathway (477129); EPH-Ephrin Signaling Pathway (1127691)

ncbi summary :

This gene is a member of the PDGF/VEGF growth factor family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Elevated levels of this protein is linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. There is also evidence for the use of non-AUG (CUG) translation initiation sites upstream of, and in-frame with the first AUG, leading to additional isoforms. [provided by RefSeq, Jul 2008]

uniprot summary :

Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth.

size1 :

0.02 mg

price1 :

660 USD

more info or order :

MyBioSource product webpage