product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Human Wnt-3a
catalog :
MBS692230
quantity :
0.025 mg
price :
265 USD
more info or order :
product information
catalog number :
MBS692230
products type :
Recombinant Protein
products full name :
Human Wnt-3a
products short name :
Wnt-3a
products name syn :
Wnt-3a
other names :
protein Wnt-3a; Protein Wnt-3a; protein Wnt-3a; wingless-type MMTV integration site family, member 3A
products gene name :
Wnt-3a
other gene names :
WNT3A; WNT3A
uniprot entry name :
WNT3A_HUMAN
host :
E Coli
reactivity :
Human
sequence length :
352
sequence :
EGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIAS AGVAFAVTRSCAEGTAAICGHMHLKCKCHGLSGSCEVKTCWWSQPDFRAI GDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEAS PNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKC RCVFHWCCYVSCQECTRVYDVHTCKLEHHHHHH
MSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFC
RNYVEIMPSVA
Protein Sequence:
purity :
>90% by SDS-PAGE & Coomassie stain
form :
Lyophilized
other info1 :
Species: Human. Conjugation: His-Tag. Stability: The lyophilized human Wnt3a, though stable at room temperature, is best stored desiccated below 0 degree C. Reconstituted human Wnt3a should be stored in working aliquots at -20 degree C. Reconstitution: Human Wnt3a should be reconstituted in 50 mM acetic acid to a concentration of 0.1 mg/ml. This is solution can be diluted in water or other buffer solutions or stored at -20 degree C.
other info2 :
Buffer: 50mM acetic acid. Length (aa): 283
products categories :
Recombinant protein; Cytokines & Growth Factors; Wnt-3a
products description :
Wnt-3a is one of about 19 vertebrate members of the Wingless-type MMTV integration site (Wnt) family of highly conserved, cysteine-rich secreted glycoproteins important for normal developmental processes. Wnts bind to receptors of the Frizzled family in conjunction with a coreceptor of the low-density lipoprotein receptor-related protein family (LRP-5 or -6), or the Ryk atypical receptor tyrosine kinase. During development, Wnt-3a is a morphogen that is thought to coordinate somitogenesis and mesoderm boundary determination. When Wnt-3a is deleted, mice fail to develop a hippocampus, and show defects in anterior-posterior patterning, somite development and tailbud formation. Wnt-3a has also been implicated in chondrocyte differentiation. Like other Wnts, Wnt-3a is modified by palmitate addition (at Cys 77) following glycosylation, which increases its hydrophobicity, secretion and activity. A second site at Ser 209 modified by palmitoleic acid also contributes. Human Wnt-3a shares 96% amino acid (aa) identity with mouse, bovine and canine Wnt-3a, and 89%, 86% and 84% aa identity with chicken, Xenopus and zebrafish Wnt-3a, respectively. It also shares 87% aa identity with Wnt-3. Human Wnt-3a is a 44 kDa secreted hydrophobic glycoprotein containing a conserved pattern of 24 cysteine residues.
ncbi gi num :
14916475
ncbi acc num :
NP_149122.1
ncbi gb acc num :
NM_033131.3
uniprot acc num :
P56704
ncbi mol weight :
38.6 kDa
ncbi pathways :
Basal Cell Carcinoma Pathway (83113); Basal Cell Carcinoma Pathway (525); Canonical Wnt Signaling Pathway (138032); Cardiac Progenitor Differentiation Pathway (712094); Class B/2 (Secretin Family Receptors) Pathway (106378); DNA Damage Response (only ATM Dependent) Pathway (198827); Defective ACTH Causes Obesity And Pro-opiomelanocortinin Deficiency (POMCD) Pathway (1127664); Disease Pathway (530764); GPCR Ligand Binding Pathway (161020); HTLV-I Infection Pathway (373901)
ncbi summary :
The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 96% amino acid identity to mouse Wnt3A protein, and 84% to human WNT3 protein, another WNT gene product. This gene is clustered with WNT14 gene, another family member, in chromosome 1q42 region. [provided by RefSeq, Jul 2008]
uniprot summary :
WNT3A: Ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube. Interacts with PORCN. Interacts with APCDD1 and WLS. Component of the Wnt-Fzd-LRP5-LRP6 signaling complex that contains a WNT protein, a FZD protein and LRP5 or LRP6. Interacts directly in the complex with LRP6. Moderately expressed in placenta and at low levels in adult lung, spleen, and prostate. Belongs to the Wnt family. Protein type: Secreted, signal peptide; Secreted. Chromosomal Location of Human Ortholog: 1q42. Cellular Component: proteinaceous extracellular matrix; extracellular space; cell surface; endoplasmic reticulum lumen; early endosome membrane; Golgi lumen; extracellular region; plasma membrane. Molecular Function: protein domain specific binding; protein binding; frizzled binding; transcription coactivator activity; receptor agonist activity; frizzled-2 binding. Biological Process: positive regulation of mesodermal cell fate specification; axon guidance; extracellular matrix organization and biogenesis; positive regulation of protein binding; positive regulation of transcription, DNA-dependent; cell proliferation in forebrain; positive regulation of receptor internalization; positive regulation of caspase activity; palate development; positive regulation of collateral sprouting in the absence of injury; Wnt receptor signaling pathway through beta-catenin; negative regulation of axon extension involved in axon guidance; Wnt receptor signaling pathway in forebrain neuroblast division; negative regulation of neurogenesis; neuron differentiation; mammary gland development; positive regulation of cell proliferation; positive regulation of B cell proliferation; hemopoiesis; heart looping; dorsoventral neural tube patterning; inner ear morphogenesis; in utero embryonic development; hippocampus development; negative regulation of fat cell differentiation; positive regulation of peptidyl-serine phosphorylation; osteoblast differentiation; paraxial mesodermal cell fate commitment; signalosome assembly; spinal cord association neuron differentiation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription factor activity; positive regulation of protein amino acid phosphorylation
size1 :
0.025 mg
price1 :
265 USD
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!