protein

Human c-reactive protein (CRP)

MBS692112

1 mg

615 USD

Recombinant Protein

Human c-reactive protein (CRP)

c-reactive protein (CRP)

CRP; PTX1

C-reactive protein; C-reactive protein; C-reactive protein; pentraxin 1; C-reactive protein, pentraxin-related

CRP

CRP; CRP; PTX1; PTX1

CRP_HUMAN

E Coli

Human

224

QTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHF
YTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVG
GSEILFEVPEVTVAPVHICTSWESASGIVEFWVDGKPRV
RKSLKKGYTVAEASIILGQEQDSFGGNFEGSQSLVGDIG
NVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQG
EVFTKPQLW

> 95% by SDS-PAGE & HPLC analyses

Liquid

Stability: The liquid CRP should be stored at all times at 4°C.

Database References: Protein RefSeq: NP_00558. Uniprot ID: P02741. mRNA RefSeq: NM_000567.2. Gene-ID (NCBI): 1401

Buffer: 20 mM Tris (pH 7.5), 2 mM CaCl2, 1.4 M NaCl, 0.05% NaN3. Biological Activity: Data not available.

Cytokines & Growth Factors

CRP is an acute phase protein that correlates with inflammatory disease and is synthesized by hepatocytes during the acute phase response by certain cytokines (IL-1 and TNF Alpha and Beta). CRP levels increase dramatically (up to 1,000 fold) and serve as a useful marker of inflammation in such conditions as bacterial infection, rheumatoid arthritis, viral infections, transplantation rejection, meningitis, myocardial infarction, septicemia, osteomyelitis and others. CRP is also highly correlated to Serum Amyloid A levels. Recombinant Human CRP produced in E.Coli is a non-glycosylated polypeptide chain having a total molecular mass of 115 kDa that corresponds to the pentamer structure of 23 kDa monomer determined by amino acid sequence. The CRP is purified by proprietary chromatographic techniques.

55770842

NP_000558.2

NM_000567.2

P02741

115 kDa (Pentamer)

Classical Antibody-mediated Complement Activation Pathway (106409); Complement Cascade Pathway (106405); Creation Of C4 And C2 Activators Pathway (106407); IL6-mediated Signaling Events Pathway (137932); Immune System Pathway (106386); Initial Triggering Of Complement Pathway (106406); Innate Immune System Pathway (106387); Selenium Pathway (198825)

The protein encoded by this gene belongs to the pentaxin family. It is involved in several host defense related functions based on its ability to recognize foreign pathogens and damaged cells of the host and to initiate their elimination by interacting with humoral and cellular effector systems in the blood. Consequently, the level of this protein in plasma increases greatly during acute phase response to tissue injury, infection, or other inflammatory stimuli. [provided by RefSeq, Sep 2009]

Function: Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. Cofactor: Binds 2 calcium ions per subunit. Subunit structure: Homopentamer. Pentaxin (or pentraxin) have a discoid arrangement of 5 non-covalently bound subunits. Subcellular location: Secreted. Tissue specificity: Found in plasma. Induction: The concentration of CRP in plasma increases greatly during acute phase response to tissue injury, infection or other inflammatory stimuli. It is induced by IL1/interleukin-1 and IL6//interleukin-6. Miscellaneous: This protein owes its name to its ability precipitate pneumococcal C-polysaccharide in the presence of calcium. Sequence similarities: Belongs to the pentaxin family.Contains 1 pentaxin domain. Mass spectrometry: Molecular mass is 23028 Da from positions 19 - 224. Determined by MALDI. Ref.15Molecular mass is 22930 Da from positions 19 - 223. Determined by MALDI. Ref.15

1 mg

615 USD