Human PRAME | MyBioSource MBS691844 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Human PRAME

catalog :

MBS691844

quantity :

0.02 mg

price :

215 USD

more info or order :

MyBioSource product webpage

image

image 1 :

image 2 :

product information

catalog number :

MBS691844

products type :

Recombinant Protein

products full name :

Human PRAME

products short name :

[PRAME]

products name syn :

[Recombinant Human PRAME (C-terminal fragment); Melanoma antigen preferentially expressed in tumors; Opa-interacting protein 4; MAPE; OIP4]

other names :

[melanoma antigen preferentially expressed in tumors; Melanoma antigen preferentially expressed in tumors; melanoma antigen preferentially expressed in tumors; cancer/testis antigen 130; opa-interacting protein 4; Opa-interacting protein OIP4; preferentially expressed antigen of melanoma; preferentially expressed antigen in melanoma; Opa-interacting protein 4; OIP-4; Preferentially expressed antigen of melanoma]

products gene name :

[PRAME]

other gene names :

[PRAME; PRAME; MAPE; OIP4; CT130; OIP-4; MAPE; OIP4; OIP-4]

uniprot entry name :

PRAME_HUMAN

host :

E Coli

reactivity :

Human

sequence length :

100

sequence :

ALLERASATLQDLVFDECGITDDQLLALLPSLSHCSQLTTLSFYGNSISI
MNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGV
MLTDVSPEPLQ

purity :

> 98% by SDS-PAGE & silver stain

form :

Lyophilized

storage stability :

Stability: The lyophilized human PRAME, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted human PRAME should be stored in working aliquots at -20°C. Reconstitution: Human PRAME should be reconstituted in water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C.

tested application :

Western blot. ELISA

app notes :

1. Positive control for Western blot analysis. 2. Standard for ELISA.

image1 heading :

Testing Data

image2 heading :

Testing Data #2

other info1 :

Stabilizer: none

other info2 :

Buffer: 10mM Tris, 25 mM NaP, pH 7.4

products categories :

Cytokines & Growth Factors

products description :

PRAME/MAPE/OIP4 is a germinal tissue-specific gene that is also expressed at high levels in haematological malignancies and solid tumors. The physiological functions of PRAME in normal and tumor cells are unknown, although a role in the regulation of retinoic acid signaling has been proposed. Sequence homology and structural predictions suggest that PRAME is related to the Leucine-rich repeat (LRR) family of proteins, which have diverse functions. PRAME, or "žpreferentially expressed antigen in melanoma", was originally identified as a gene encoding a HLA-A24 restricted antigenic peptide presented to autologous tumor-specific cytotoxic T lymphocytes derived from a patient with melanoma. PRAME is synonymous with MAPE (melanoma antigen preferentially expressed in tumors) and OIP4 (OPA-interacting protein 4), and its expression profile defines it as a cancer-testis antigen. Cancer-testis antigens (CTAs) are encoded by non-mutated genes expressed at high levels in germinal tissues and tumors, but which are absent from or detected at low levels in other tissues. PRAME may be somewhat different to other cancer-testis antigens in that it shows some expression in normal tissues such as ovary, adrenal, placenta and endometrium. The C-terminus of human PRAME (amino acids 453-509) was also identified to bind Neisseria gonorrhoeae opacity factors, in this case the OPA-P protein. Thus PRAME is also known as OIP4 (OPA interacting protein), although the functional implications of the interaction are unknown.

products references :

1. Ikeda H et al, Immunity 1997, 6:199-208 2. Haqq C et al, Proc Natl Acad Sci USA 2005, 102:6092 3. Williams JM et al, Mol Microbiol 1998, 27:171-186 4. Nakamura Y et al, Ann Surg Oncol 2007, 14:885-892

ncbi gi num :

5174641

ncbi acc num :

NP_006106.1

ncbi gb acc num :

NM_006115.3

uniprot acc num :

P78395

ncbi mol weight :

10.7 kDa

ncbi summary :

This gene encodes an antigen that is predominantly expressed in human melanomas and that is recognized by cytolytic T lymphocytes. It is not expressed in normal tissues, except testis. This expression pattern is similar to that of other CT antigens, such as MAGE, BAGE and GAGE. However, unlike these other CT antigens, this gene is also expressed in acute leukemias. Five alternatively spliced transcript variants encoding the same protein have been observed for this gene. [provided by RefSeq, Jul 2008]

uniprot summary :

Function: Functions as a transcriptional repressor, inhibiting the signaling of retinoic acid through the retinoic acid receptors RARA, RARB and RARG. Prevents retinoic acid-induced cell proliferation arrest, differentiation and apoptosis. Ref.7. Subunit structure: Interacts with RARA (via the ligand-binding domain); the interaction is direct and ligand (retinoic acid)-dependent. Interacts with EZH2; required to repress RAR signaling. Ref.7. Subcellular location: Nucleus . Probable. Cell membrane Ref.8. Tissue specificity: Expressed in testis. Detected in samples of kidney, brain and skin. Ref.1. Miscellaneous: Tumor antigen recognized by cytolytic T lymphocytes. Sequence similarities: Belongs to the PRAME family.Contains 4 LRR (leucine-rich) repeats.

size1 :

0.02 mg

price1 :

215 USD

more info or order :

MyBioSource product webpage