product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Soluble Neuropilin-1
catalog :
MBS691772
quantity :
0.005 mg
price :
185 USD
more info or order :
product information
catalog number :
MBS691772
products type :
Recombinant Protein
products full name :
Recombinant Human Soluble Neuropilin-1
products short name :
[NRP-1, soluble]
products name syn :
[Vascular endothelial growth factor 165 receptor,CD304, VEGF165R, NRP]
other names :
[neuropilin-1 isoform b; Neuropilin-1; neuropilin-1; transmembrane receptor; vascular endothelial cell growth factor 165 receptor; neuropilin 1; Vascular endothelial cell growth factor 165 receptor]
products gene name :
[NRP-1]
other gene names :
[NRP1; NRP1; NP1; NRP; BDCA4; CD304; VEGF165R; NRP; VEGF165R]
uniprot entry name :
NRP1_HUMAN
host :
Insect cells
reactivity :
Human
sequence length :
644
sequence :
NPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFI KFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSL ECTYIVFAPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVG PHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSE DFKCMEALGMESGEIHSDQITASSQYSTNWSAERSRLNYPENGWTPGEDS YREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKIDVSSNGEDWIT IKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFEV YGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGW ALPPAPHSYINEWLQIDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSN NGSDWKMIMDDSKRKAKSFEGNNNYDTPELRTFPALSTRFIRIYPERATH GGLGLRMELLGCEVEAPTAGPTTPNGNLVDECDDDQANCHSGTGDDFQLT GGTTVLATEKPTVIDSTIQSGIKLEHHHHHH
FRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQA
PDPYQRIMINF
purity :
>98% by SDS-PAGE & Coomassie stain
form :
Lyophilized
storage stability :
The material is stable for greater than six months at -20° C to -70° C. After the first thawing it is recommended to aliquot the material, because repeated freeze-thaw cycles will decrease the activity. Store at 4°C not longer than 2 days.
image1 heading :
SDS-PAGE
image2 heading :
ELISA
other info1 :
Result by N-Terminal Sequencing: FRNDKCGDTI. Protein RefSeq: NP_003864.4. mRNA RefSeq: NM_003873.5. Buffer: PBS. Stabilizer: None
other info2 :
Length (aa): 631. Reconstitution: The lyophilized human sNRP-1 is soluble in water and most aqueous buffers; it should be reconstituted in water or PBS to a concentration of not lower than 100ug/ml. Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized soluble Neuropilin-1 binds all VEGF-A isoforms with the exception of VEGF 121 .
products categories :
Soluble Receptors
products description :
Neuropilin-1 (NRP-1, CD304) is a 130-140 kDa type I transmembrane glycoprotein that regulates axon guidance and angiogenesis. The human NRP-1 contains a 623 aa extracellular domain (ECD) that shows 92-95% aa identity with mouse, rat, bovine and canine NRP-1. The ECD contains two N-terminal CUB domains (termed a1a2), two domains with homology to coagulation factors V and VIII (b1b2) and a MAM (meprin) domain. C-terminally divergent splice variants with 704, 644, 609, and 551 aa lack the MAM and TM domains and are demonstrated or presumed to be soluble antagonists. Heparin, the heparin-binding forms of VEGF (VEGF165, VEGF-B; VEGF-E), PlGF-2, and the C-terminus of Sema3 bind the b1b2 region. NRP-1 and NRP-2 share 48% aa identity within the ECD and can form homo and hetero-oligomers via interaction of their MAM domains. Neuropilins show partially overlapping expression in neuronal and endothelial cells during development. Both neuropilins act as coreceptors with Plexins, mainly Plexin A3 and A4, to bind class III Semaphorins that mediate axon repulsion. However, only NRP-1 binds Sema3A, and only NRP-2 binds Sema 3F. Both are co-receptors with VEGFR-2 (KDR7Flk1) for VEGF165 binding. Sema 3A signaling can be blocked by VEGF165, which has higher affinity for NRP-1. NRP-1 is preferentially expressed in arteries during development or those undergoing remodeling. NRP-1 is also expressed on dendritic cells and mediates DC-induced T-cell proliferation.
ncbi gi num :
66912178
ncbi acc num :
NP_001019799.1
ncbi gb acc num :
NM_001024628.2
uniprot acc num :
O14786
ncbi mol weight :
82,6 kDa
ncbi pathways :
Axon Guidance Pathway (83065); Axon Guidance Pathway (476); Axon Guidance Pathway (105688); CHL1 Interactions Pathway (161007); CRMPs In Sema3A Signaling Pathway (119525); Developmental Biology Pathway (477129); HTLV-I Infection Pathway (373901); HTLV-I Infection Pathway (373889); L1CAM Interactions Pathway (161003); Neurophilin Interactions With VEGF And VEGFR Pathway (106509)
ncbi summary :
This gene encodes one of two neuropilins, which contain specific protein domains which allow them to participate in several different types of signaling pathways that control cell migration. Neuropilins contain a large N-terminal extracellular domain, made up of complement-binding, coagulation factor V/VIII, and meprin domains. These proteins also contains a short membrane-spanning domain and a small cytoplasmic domain. Neuropilins bind many ligands and various types of co-receptors; they affect cell survival, migration, and attraction. Some of the ligands and co-receptors bound by neuropilins are vascular endothelial growth factor (VEGF) and semaphorin family members. Several alternatively spliced transcript variants that encode different protein isoforms have been described for this gene. [provided by RefSeq, Oct 2011]
uniprot summary :
Function: The membrane-bound isoform 1 is a receptor involved in the development of the cardiovascular system, in angiogenesis, in the formation of certain neuronal circuits and in organogenesis outside the nervous system. It mediates the chemorepulsant activity of semaphorins. It binds to semaphorin 3A, The PLGF-2 isoform ofPGF, The VEGF-165 isoform ofVEGF and VEGF-B. Coexpression with KDR results in increased VEGF-165 binding to KDR as well as increased chemotaxis. It may regulate VEGF-induced angiogenesis.The soluble isoform 2 binds VEGF-165 and appears to inhibit its binding to cells. It may also induce apoptosis by sequestering VEGF-165. May bind as well various members of the semaphorin family. Its expression has an averse effect on blood vessel number and integrity. Subunit structure: Homodimer, and heterodimer with NRP2. Interacts with FER . By similarity. Binds PLXNB1. Ref.10 Ref.16. Subcellular location: Cell membrane; Single-pass type I membrane protein. Isoform 2: Secreted. Tissue specificity: The expression of isoforms 1 and 2 does not seem to overlap. Isoform 1 is expressed by the blood vessels of different tissues. In the developing embryo it is found predominantly in the nervous system. In adult tissues, it is highly expressed in heart and placenta; moderately in lung, liver, skeletal muscle, kidney and pancreas; and low in adult brain. Isoform 2 is found in liver hepatocytes, kidney distal and proximal tubules. Domain: The tandem CUB domains mediate binding to semaphorin, while the tandem F5/8 domains are responsible for heparin and VEGF binding. Sequence similarities: Belongs to the neuropilin family.Contains 2 CUB domains.Contains 2 F5/8 type C domains.Contains 1 MAM domain.
size1 :
0.005 mg
price1 :
185 USD
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!