product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Human BMP receptor-1A, soluble
catalog :
MBS691658
quantity :
0.1 mg
price :
345 USD
more info or order :
product information
catalog number :
MBS691658
products type :
Recombinant Protein
products full name :
Human BMP receptor-1A, soluble
products short name :
BMP receptor-1A, soluble
products name syn :
Recombinant Human Soluble BMP Receptor Type-1A; Bone morphogenetic protein receptor type-1A; Activin receptor-like kinase 3; CD292
other names :
bone morphogenetic protein receptor type-1A; Bone morphogenetic protein receptor type-1A; bone morphogenetic protein receptor type-1A; ALK-3; BMPR-1A; BMP type-1A receptor; activin receptor-like kinase 3; activin A receptor, type II-like kinase 3; serine/threonine-protein kinase receptor R5; bone morphogenetic protein receptor, type IA; Activin receptor-like kinase 3; ALK-3; Serine/threonine-protein kinase receptor R5
products gene name :
BMP receptor-1A
other gene names :
BMPR1A; BMPR1A; ALK3; SKR5; CD292; ACVRLK3; 10q23del; ACVRLK3; ALK3; BMP type-1A receptor; BMPR-1A; ALK-3; SKR5
uniprot entry name :
BMR1A_HUMAN
host :
Insect Cells
reactivity :
Human
sequence length :
135
sequence :
NTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIE CCRTNLCNQYLQPTLPPVVIGPFFDGSIRHHHHHH
QNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCY
CSGHCPDDAIN
purity :
> 90% by SDS-PAGE & silver stain
form :
Lyophilized
storage stability :
Lyophilized samples are stable for greater than six months at -20 degree C to -70 degree C. Reconstituted sBMPR-1A should be stored in working aliquots at -20 degree C.
other info2 :
Buffer: PBS. Reconstitution: The lyophilized sBMPR-1A is soluble in water and most aqueous buffers and should be reconstituted in PBS or medium to a concentration not lower than 50ug/ml. Biological Activity: Measured by its ability to inhibit recombinant human BMP-2 induced alkaline phosphatase production by C2C12 myogenic cells. The ED 50 for this effect is typically 1-4 ug/ml in the presence of 500ng/ml of recombinant human BMP-2.
products categories :
Soluble Receptors
products description :
The extracellular domain of human BMPR-IA was fused with a carboxy-terminal 6X histidine-tag. The monomeric glycoprotein was expressed in baculovirus infected insect cells. Cellular responses to bone morphogenetic proteins (BMPs) have been shown to be mediated by the formation of hetero-oligomeric complexes of the type I and type II serine/threonine kinase receptors. BMP receptor 1A (BMPR-1A), also known as activin receptor-like kinase (ALK)-3, is a one of seven known type I serine/threonine kinases that are required for the signal transduction of TGF-b family cytokines. In contrast to the TGF-b receptor system in which the type I receptor does not bind TGF-b in the absence of the type II receptor, type I receptors involved in BMP signaling (including BMPR-IA, BMPR-IB/ALK-6, and ActR-I/ALK-2) can independently bind the various BMP family proteins in the absence of type II receptors. Recombinant soluble BMPR-IA binds BMP-2 and -4 with high-affinity in solution and is a potent BMP-2/4 antagonist in vitro. BMPR-IA is ubiquitously expressed during embryogenesis. In adult tissues, BMPR-IA mRNA is also widely distributed; with the highest expression levels found in skeletal muscle. The extracellular domain of BMPR-IA shares little amino acid sequence identity with the other mammalian ALK type I receptor kinases, but the cysteine residues are conserved. Human and mouse BMPR-IA are highly conserved and share 98% sequence identity.
products references :
1. Wu MY and CS Hill Dev Cell 16:329, 2009 2. Nickel J et al, Cytokine Growth Factor Rev 20:367, 2009 3. de Caestecker M, Cytokine Growth Factor Rev 15:1, 2004 4. Schmal H et al, Cytotherapy 14(7):868-76, 2012 5. Liu R etal, BMC Musculoskelet Disord 15;10:51, 2009
ncbi gi num :
41349437
ncbi acc num :
NP_033888
ncbi gb acc num :
NM_009758
uniprot acc num :
P36894
ncbi mol weight :
23 kDa (Monomer)
ncbi pathways :
BMP Signalling And Regulation Pathway (198910); Cytokine-cytokine Receptor Interaction Pathway (83051); Cytokine-cytokine Receptor Interaction Pathway (460); Endochondral Ossification Pathway (198812); Heart Development Pathway (198802); Hippo Signaling Pathway (749777); Hippo Signaling Pathway (750388); Integrated Breast Cancer Pathway (219801); Signal Transduction Pathway (477114); Signaling By BMP Pathway (106336)
ncbi summary :
The bone morphogenetic protein (BMP) receptors are a family of transmembrane serine/threonine kinases that include the type I receptors BMPR1A and BMPR1B and the type II receptor BMPR2. These receptors are also closely related to the activin receptors, ACVR1 and ACVR2. The ligands of these receptors are members of the TGF-beta superfamily. TGF-betas and activins transduce their signals through the formation of heteromeric complexes with 2 different types of serine (threonine) kinase receptors: type I receptors of about 50-55 kD and type II receptors of about 70-80 kD. Type II receptors bind ligands in the absence of type I receptors, but they require their respective type I receptors for signaling, whereas type I receptors require their respective type II receptors for ligand binding. [provided by RefSeq, Jul 2008]
uniprot summary :
Function: On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for BMP-2 and BMP-4. Catalytic activity: ATP + [receptor-protein] = ADP + [receptor-protein] phosphate. Cofactor: Magnesium or manganese . By similarity. Subcellular location: Membrane; Single-pass type I membrane protein. Tissue specificity: Highly expressed in skeletal muscle. Involvement in disease: Juvenile polyposis syndrome (JPS) [MIM:174900]: Autosomal dominant gastrointestinal hamartomatous polyposis syndrome in which patients are at risk for developing gastrointestinal cancers. The lesions are typified by a smooth histological appearance, predominant stroma, cystic spaces and lack of a smooth muscle core. Multiple juvenile polyps usually occur in a number of Mendelian disorders. Sometimes, these polyps occur without associated features as in JPS; here, polyps tend to occur in the large bowel and are associated with an increased risk of colon and other gastrointestinal cancers.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.6 Ref.7 Ref.8 Ref.9 Ref.10Polyposis syndrome, mixed hereditary 2 (HMPS2) [MIM:610069]: A disease is characterized by atypical juvenile polyps, colonic adenomas, and colorectal carcinomas.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.6A microdeletion of chromosome 10q23 involving BMPR1A and PTEN is a cause of chromosome 10q23 deletion syndrome, which shows overlapping features of the following three disorders: Bannayan-Zonana syndrome, Cowden disease and juvenile polyposis syndrome. Ref.6. Sequence similarities: Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.Contains 1 GS domain.Contains 1 protein kinase domain.
size1 :
0.1 mg
price1 :
345 USD
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!