Human PlGF-1 | MyBioSource MBS691600 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Human PlGF-1

catalog :

MBS691600

quantity :

0.02 mg

price :

530 USD

more info or order :

MyBioSource product webpage

image

image 1 :

Fig. 1: SDS-PAGE analysis of recombinant human PlGF-1. Samples were loaded in 15% SDS-polyacrylamide gel under non-reducing conditions and stained with Coomassie blue.

image 2 :

Figure 2. PlGF Sandwich-ELISA using recombinant human PlGF-1 as standard [ MBS691506 ]. Mouse anti-human PlGF #178/G10 ( MBS691018 ) was used as capture antibody, Biotinylated rabbit anti-human PlGF ( MBS692203 ) was used for detection.

product information

catalog number :

MBS691600

products type :

Recombinant Protein

products full name :

Human PlGF-1

products short name :

[PlGF-1]

products name syn :

[Recombinant Human Placenta Growth Factor-1; PlGF; Placenta Growth Factor]

other names :

[placenta growth factor isoform 2; Placenta growth factor; placenta growth factor; placental growth factor, vascular endothelial growth factor-related protein; placental growth factor]

products gene name :

[PlGF-1]

other gene names :

[PGF; PGF; PGFL; PLGF; PlGF-2; D12S1900; SHGC-10760; PGFL; PLGF; PlGF]

uniprot entry name :

PLGF_HUMAN

host :

Insect Cells

reactivity :

Human

sequence length :

131

sequence :

LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALER
LVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVP
VETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLRE
KMKPERCGDAPRR

purity :

> 95% by SDS-PAGE & silver stain

form :

Lyophilized

storage stability :

The lyophilized human PIGF-1, though stable at room temperature, is best stored in working aliquots at -20°C to -70°C. Avoid repeated freeze-thaw cycles.

image1 heading :

SDS-PAGE

image2 heading :

ELISA

other info2 :

Buffer: 50 mM acetic acid. Stabilizer: BSA. Length (aa): 131. Result by N-terminal sequencing: LPAVPPQQWA. Reconstitution: Centrifuge the vial prior to opening! The PlGF-1 is supplied in lyophilized form with carrier-protein (BSA) and can be reconstituted with 50mM acetic acid or PBS/water. This solution can be diluted into other buffered solutions or stored frozen for future use. Biological Activity: Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant human PlGF-1 can bind to immobilized rh-sFlt-1 (100 ng/well) with a linear range at 0.5 - 10 ng/mL.

products categories :

Cytokines & Growth Factors

products description :

Human Placenta Growth Factor-1 (PlGF-1), a 19 kDa protein consisting of 131 amino acid residues is produced as a homodimer. Human Placenta Growth Factor (PlGF) is a polypeptide growth factor and a member of the platelet-derived growth factor family but more related to vascular endothelial growth factor (VEGF). PlGF-1 acts only as a very weak mitogen for some endothelial cell types and as a potent chemoattractant for monocytes. The physiological function in vivo is still controversial. In several reports it was shown not to be a potent mitogen for endothelial cells and not angiogenic in vivo by using different assays. Very recently it was shown by one investigator, that PlGF-1 from cell culture supernatants was angiogenic in the CAM assay and in the rabbit cornea assay. At least one high-affinity receptor for PlGF (FLT-1 or VEGF-R1) has been demonstrated in different primary cell types (e.g. human umbilical vein endothelial cells and monocytes) but PlGF does not bind to KDR/flk-1. Two different proteins can be generated by differential splicing of the human PlGF gene: PlGF-1 (131 aa native chain) and PlGF-2 (152 aa native chain). Both mitogens are secretable proteins, but PlGF-2 can bind to heparin with high affinity. PlGF-1 is a homodimer, but preparations of PlGF show some heterogeneity on SDS gels depending of the varying degrees of glycosylation. All dimeric forms posses a similar biological profile. There is good evidence that heterodimeric molecules between VEGF and PlGF exists and that they are biological active. Different cells and tissues (e.g. placenta) express PlGF-1 and PlGF-2 at different rates. A very related protein of PlGF is VEGF with about 53% homology and VEGF-B with similar biological activities.

products references :

1. DiPalma, T. et al. (1996) Mamm. Genome 7:6. 2. Cao, Y. et al. (1997) Biochem. Biophys. Res. Commun. 235:493. 3. Ferrara, N. et al. (1997) Endocrin. Rev. 18:4 4. Kim KJ et al, Exp Mol Med 44:10-9, 2012 5. De Falco S, Exp Mol Med 44:1-9, 2012

ncbi gi num :

333033785

ncbi acc num :

NP_001193941.1

ncbi gb acc num :

NM_001207012.1

uniprot acc num :

P49763

ncbi mol weight :

~34 kDa (Dimer)

ncbi pathways :

Focal Adhesion Pathway (198795); Focal Adhesion Pathway (83067); Focal Adhesion Pathway (478); PI3K-Akt Signaling Pathway (692234); PI3K-Akt Signaling Pathway (692979); Pathways In Cancer (83105); Rap1 Signaling Pathway (868086); Rap1 Signaling Pathway (878042); Ras Signaling Pathway (868085); Signal Transduction Pathway (477114)

ncbi summary :

This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene.[provided by RefSeq, Jun 2011]

uniprot summary :

Function: Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. Also promotes cell tumor growth. Ref.8. Subunit structure: Antiparallel homodimer; disulfide-linked. Also found as heterodimer with VEGFA/VEGF. Isoform PlGF-3 is found both as homodimer and as monomer. Subcellular location: Secreted. Note: The three isoforms are secreted but PlGF-2 appears to remain cell attached unless released by heparin. Tissue specificity: While the three isoforms are present in most placental tissues, PlGF-2 is specific to early (8 week) placenta and only PlGF-1 is found in the colon and mammary carcinomas. Domain: Isoform PlGF-2 contains a basic insert which acts as a cell retention signal. Post-translational modification: N-glycosylated. Sequence similarities: Belongs to the PDGF/VEGF growth factor family.

size1 :

0.02 mg

price1 :

530 USD

more info or order :

MyBioSource product webpage