product summary
Loading...
company name :
MyBioSource
product type :
other
product name :
3-Acetylpyridine-Adenine Dinucleotide, Oxidized (APAD)
catalog :
MBS682159
quantity :
100 mg
price :
350 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS682159
products type :
Substrate
products full name :
3-Acetylpyridine-Adenine Dinucleotide, Oxidized (APAD)
products short name :
[3-Acetylpyridine-Adenine Dinucleotide, Oxidized]
products name syn :
[3-Acetylpyridine-Adenine Dinucleotide, Oxidized; APAD]
products gene name :
[APAD]
sequence :
MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLIL
ICLLLICIIVMLL
purity :
92%
form :
Lyophilized Powder
storage stability :
Shor-term storage : 1-10 degree C. Long-term storage: below - 20 degree C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
image1 heading :
SDS-PAGE
other info1 :
CAS No: 86-08-8. Formula Weight: 662.4 (as anhydrous free acid). 680.5 (as monohydrate). Formula: C 22 H 28 N 6 O 14 P 2
other info2 :
Water Contents: 2.7% . APAD* contents: 89.5% . Spectral Analysis: Ratio at pH 7.5:. A 250 /A 260 : 0.81. A 280 /A 260 : 0.22
products categories :
Substrates
size1 :
100 mg
price1 :
350 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!