product summary
Loading...
company name :
MyBioSource
product type :
other
product name :
PD-L1 Stable Cell Line
catalog :
MBS668871
quantity :
1 Vial
price :
1690 USD
more info or order :
image
image 1 :
MyBioSource MBS668871 image 1
Fig-1: Detection of human PD-L1 in the CHO-K1/PD-L1 stable cell line by Flow Cytometry [Cell surface staining]. CHO-K1 cells (Green); CHO-K1/PD-L1 cells (Red).
product information
catalog number :
MBS668871
products type :
Cell Line
products full name :
PD-L1 Stable Cell Line
products short name :
[PD-L1]
other names :
[programmed cell death 1 ligand 1 isoform c; Programmed cell death 1 ligand 1; programmed cell death 1 ligand 1; CD274 molecule; B7 homolog 1; B7-H1; CD_antigen: CD274]
products gene name :
[PD-L1]
other gene names :
[CD274; CD274; B7-H; B7H1; PDL1; PD-L1; PDCD1L1; PDCD1LG1; B7H1; PDCD1L1; PDCD1LG1; PDL1; PD-L1; PDCD1 ligand 1; Programmed death ligand 1; B7-H1]
sequence length :
245
sequence :
DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH LVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET
MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIE
CKFPVEKQLDLAALIVYWEME
form :
Each vial contains 2 ~ 3 x 10^6 cells in 1 ml of 90% FBS + 10% DMSO.
storage stability :
Immediately upon receipt, store in liquid nitrogen.
tested application :
Functional Assay
app notes :
Screen for antibodies of human PD-L1 through Flow Cytometry, Immunocytochemistry or Western blotting
image1 heading :
Testing Data
other info1 :
Culture Conditions: Cells should be grown at 37oC with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS supplemented with 10% FBS and 1% Pen/Strep, plus 10 ug/mlof Blasticidin. It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37°C water-bath, transfer to atube containing 10 ml of growth medium without Blasticidin, spin down cells, resuspend cells in pre-warmed growth medium without Blasticidin, transfer resuspended cells to T25 flask and culture in 37°C-CO2 incubator. Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completelyrecover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Blasticidin. Cells should be split before they reach complete confluence. To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times. Shipping Note: Product available only in the USA.
other info2 :
Dry Ice Shipment: Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
products categories :
Cell Lines; Stable Cell Lines
products description :
PD-L1 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human Programmed Death- Ligand 1 (PD-L1, also known as CD275 and B7-H1).
ncbi gi num :
930425329
ncbi acc num :
NP_001300958.1
ncbi gb acc num :
NM_001314029.1
ncbi pathways :
Adaptive Immune System Pathway (1269171); Cell Adhesion Molecules (CAMs) Pathway (83069); Cell Adhesion Molecules (CAMs) Pathway (480); Costimulation By The CD28 Family Pathway (1269177); Immune System Pathway (1269170); PD-1 Signaling Pathway (1269182)
ncbi summary :
This gene encodes an immune inhibitory receptor ligand that is expressed by hematopoietic and non-hematopoietic cells, such as T cells and B cells and various types of tumor cells. The encoded protein is a type I transmembrane protein that has immunoglobulin V-like and C-like domains. Interaction of this ligand with its receptor inhibits T-cell activation and cytokine production. During infection or inflammation of normal tissue, this interaction is important for preventing autoimmunity by maintaining homeostasis of the immune response. In tumor microenvironments, this interaction provides an immune escape for tumor cells through cytotoxic T-cell inactivation. Expression of this gene in tumor cells is considered to be prognostic in many types of human malignancies, including colon cancer and renal cell carcinoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]
uniprot summary :
CD274: Involved in the costimulatory signal, essential for T- cell proliferation and production of IL10 and IFNG, in an IL2- dependent and a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation and cytokine production. Belongs to the immunoglobulin superfamily. BTN/MOG family. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral. Chromosomal Location of Human Ortholog: 9p24.1. Cellular Component: plasma membrane. Molecular Function: protein binding. Biological Process: cell surface receptor linked signal transduction; immune response; negative regulation of activated T cell proliferation; negative regulation of interferon-gamma production; negative regulation of interleukin-10 production; positive regulation of T cell proliferation; regulation of activated T cell proliferation; response to cytokine stimulus; signal transduction; T cell costimulation
size1 :
1 Vial
price1 :
1690 USD
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!