other

CTLA4 Stable Cell Line

MBS668851

1 Vial

1690 USD

Cell Line

CTLA4 Stable Cell Line

[CTLA4]

[cytotoxic T-lymphocyte protein 4 isoform CTLA4-TM; Cytotoxic T-lymphocyte protein 4; cytotoxic T-lymphocyte protein 4; cytotoxic T-lymphocyte associated protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD_antigen: CD152]

[CTLA4]

[CTLA4; CTLA4; CD; GSE; GRD4; ALPS5; CD152; CTLA-4; IDDM12; CELIAC3; CD152; CTLA-4]

MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMH
VAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQAD
SQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQ
GLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEP
CPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSP
LTTGVYVKMPPTEPECEKQFQPYFIPIN

Each vial contains 2~3 x 10 6 cells in 1 ml of 90% FBS + 10% DMSO.

Immediately upon receipt, store in liquid nitrogen.

Functional Assay

Screen for antibodies of human CTLA4 through Flow Cytometry, Immunocytochemistry or Western blotting.

Testing Data

Sequence Data: hCTLA4 (accession number NM_005214). Culture Conditions: Cells should be grown at 37°C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS supplemented with 10% FBS and 1% Pen/Strep, plus 10 ug/ml of Blasticidin. It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37°C water-bath, transfer to a tube containing 10 ml of growth medium without Blasticidin, spin down cells, resuspend cells in pre-warmed growth medium without Blasticidin, transfer resuspended cells to T25 flask and culture in 37°C-CO 2 incubator. Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completely recover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Blasticidin. Cells should be split before they reach complete confluence. To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times.

Dry Ice Shipment: Extra charge fee may add to your shipping cost as dry ice is required to ship this product.

Cell Lines; Stable Cell Lines

CTLA4 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human Cytotoxic T-Lymphocyte-Associated Protein 4 (CTLA4, also known as CD152).

21361212

NP_005205.2

NM_005214.4

P16410

Adaptive Immune System Pathway (366160); Autoimmune Thyroid Disease Pathway (83121); Autoimmune Thyroid Disease Pathway (533); CTLA4 Inhibitory Signaling Pathway (119556); Calcineurin-regulated NFAT-dependent Transcription In Lymphocytes Pathway (137993); Cell Adhesion Molecules (CAMs) Pathway (83069); Cell Adhesion Molecules (CAMs) Pathway (480); Costimulation By The CD28 Family Pathway (119552); Immune System Pathway (106386); Rheumatoid Arthritis Pathway (200309)

This gene is a member of the immunoglobulin superfamily and encodes a protein which transmits an inhibitory signal to T cells. The protein contains a V domain, a transmembrane domain, and a cytoplasmic tail. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The membrane-bound isoform functions as a homodimer interconnected by a disulfide bond, while the soluble isoform functions as a monomer. Mutations in this gene have been associated with insulin-dependent diabetes mellitus, Graves disease, Hashimoto thyroiditis, celiac disease, systemic lupus erythematosus, thyroid-associated orbitopathy, and other autoimmune diseases. [provided by RefSeq, Jul 2008]

CTLA-4: Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28. Genetic variation in CTLA4 influences susceptibility to systemic lupus erythematosus (SLE). SLE is a chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. SLE is thought to represent a failure of the regulatory mechanisms of the autoimmune system. Genetic variations in CTLA4 may influence susceptibility to Graves disease, an autoimmune disorder associated with overactivity of the thyroid gland and hyperthyroidism. Genetic variation in CTLA4 is the cause of susceptibility to diabetes mellitus insulin-dependent type 12 (IDDM12). A multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical fetaures are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These derangements result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels. Genetic variation in CTLA4 is the cause of susceptibility to celiac disease type 3 (CELIAC3). It is a multifactorial disorder of the small intestine that is influenced by both environmental and genetic factors. It is characterized by malabsorption resulting from inflammatory injury to the mucosa of the small intestine after the ingestion of wheat gluten or related rye and barley proteins. In its classic form, celiac disease is characterized in children by malabsorption and failure to thrive. 4 isoforms of the human protein are produced by alternative splicing. Protein type: Immunoglobulin superfamily; Membrane protein, integral. Chromosomal Location of Human Ortholog: 2q33.2. Cellular Component: clathrin-coated endocytic vesicle; external side of plasma membrane; Golgi apparatus; integral to plasma membrane; perinuclear region of cytoplasm; plasma membrane. Molecular Function: protein binding. Biological Process: B cell receptor signaling pathway; immune response; negative regulation of B cell proliferation; negative regulation of regulatory T cell differentiation; positive regulation of apoptosis; response to DNA damage stimulus; T cell costimulation. Disease: Autoimmune Lymphoproliferative Syndrome, Type V; Celiac Disease, Susceptibility To, 3; Diabetes Mellitus, Insulin-dependent, 12; Hashimoto Thyroiditis; Systemic Lupus Erythematosus

1 Vial

1690 USD