product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Nerve Growth Factor, pro, Recombinant, Human (NGF)
catalog :
MBS650308
quantity :
0.002 mg
price :
275 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS650308
products type :
Recombinant Protein
products full name :
Nerve Growth Factor, pro, Recombinant, Human (NGF)
products short name :
Nerve Growth Factor, pro
other names :
Nerve growth factor
sequence :
FSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVM. VLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTA. CVCVLSRKAVR
MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPA
AAIAARVAGQTRNITVDPRLFKKRRLRSPRVL.
purity :
Highly Purified. 98% as determined by SDS-PAGE
form :
Supplied as a liquid in PBS, pH 7.2.
storage stability :
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 6 months at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
other info1 :
Biological Activity: The activity of the protein can by measured by its stimulating effect on the proliferation of TF1 cells (Chevalier et al. 1994 Blood 83, 1479-85). EC50 130 30 pM (TF1 cell assay)
products categories :
Growth Factors, Cytokines; Growth Factors-NGF
products description :
ProNGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein proNGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer. Recombinant Human Pro-NGF produced in E.coli is a non-glycosylated, polypeptide chain containing 222 amino acids and having a molecular mass of 49,738 Dalton.
ncbi gi num :
4033770
ncbi mol weight :
49.74kD
ncbi pathways :
Focal Adhesion Pathway (83067); Focal Adhesion Pathway (478); MAPK Signaling Pathway (83048); MAPK Signaling Pathway (456); Salmonella Infection Pathway (375172); Salmonella Infection Pathway (375149)
size1 :
0.002 mg
price1 :
275 USD
size2 :
0.01 mg
price2 :
340
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!