MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPA
AAIAARVAGQTRNITVDPRLFKKRRLRSPRVL.

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Growth Differentiation Factor 3, Recombinant, Mouse (GDF3) | MBS650309
- Erythropoietin, Recombinant, Human (EPO) | MBS650641
- Growth and Differentiation Factor 5, 382-501aa, Recombinant, Human (GDF5)
- Interleukin 8, Recombinant, Human (IL-8) | MBS650704
- Interleukin 1 Receptor Antagonist, Recombinant, Human (IL-1RA, IL1RA, IL-1ra3, I ...
