protein

Neuregulin 1, Recombinant, Human (NRG1, NDF)

MBS650011

0.01 mg

275 USD

Recombinant Protein

Neuregulin 1, Recombinant, Human (NRG1, NDF)

Neuregulin 1

Neuregulin 1; Neuregulin 1 isoform SMDF variant; pro-neuregulin-1, membrane-bound isoform; MSTP131; pro-NRG1; OTTHUMP00000225398; OTTHUMP00000225419; OTTHUMP00000225420; OTTHUMP00000225421; OTTHUMP00000225422; OTTHUMP00000225477; OTTHUMP00000225545; OTTHUMP00000230603; OTTHUMP00000230605; glial growth factor; neu differentiation factor; neuregulin 1 type IV beta 3; neuregulin 1 type IV beta 1a; sensory and motor neuron derived factor; heregulin, alpha (45kD, ERBB2 p185-activator); neuregulin 1

NRG1; GGF; HGL; HRG; NDF; ARIA; GGF2; HRG1; HRGA; SMDF; MST131

Q53F54_HUMAN

E Coli

SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNE
FTGDRCQNYVMASFYKAEELYQ

Highly Purified. 95% as determined by RP-HPLC, anion-exchange FPLC and/or reducing and non-reducing SDS-PAGE Silver Stained gel.

Supplied as a lyophilized powder from 20mM phosphate buffer, pH 7.4, 150mM sodium chloride. Reconstitute with sterile ddH2O, to a concentration of 100ug/ml.

Lyophilized powder may be stored at -20 degree C. Stable for 12 months at -20 degree C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Biological Activity: The activity measured by its ability to stimulate the proliferation of human MCF-7 cells grown under serum-free conditions corresponding to a specific activity of 1.2x10e4 units/mg.

Growth Factors, Cytokines; Growth Factors-Other

Neuregulin is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells, playing an important role in heart structure and function through inducing ErbB2/ErbB4 receptor phosphorylation and cardiomyocyte differentiation. Research on molecular level discovered that recombinant neuregulin could make disturbed myocardial cell structure into order and strengthen the connection between myocardial cells by intercalated discs re-organization. Pharmacodynamic experiments in animals showed that recombinant neuregulin (NRG1) can reduce the degree of damage on myocardial cells caused by ischemia, hypoxia and viral infection. Recombinant Human Neuroregulin-1 (Neu differentiation factor) produced in E. coli is a single, non-glycosylated polypeptide chain containing 61 amino acids having a molecular mass of 7055D. Recombinant Human NRG1 is purified by proprietary chromatographic techniques.

49522883

Q53F54

7.1kD

ErbB Signaling Pathway (198844); ErbB Signaling Pathway (83049); ErbB Signaling Pathway (458); Glypican 1 Network Pathway (138010); MicroRNAs In Cardiomyocyte Hypertrophy Pathway (198784)

The protein encoded by this gene was originally identified as a 44-kD glycoprotein that interacts with the NEU/ERBB2 receptor tyrosine kinase to increase its phosphorylation on tyrosine residues. This protein is a signaling protein that mediates cell-cell interactions and plays critical roles in the growth and development of multiple organ systems. It is known that an extraordinary variety of different isoforms are produced from this gene through alternative promoter usage and splicing. These isoforms are tissue-specifically expressed and differ significantly in their structure, and thereby these isoforms are classified into types I, II, III, IV, V and VI. The gene dysregulation has been linked to diseases such as cancer, schizophrenia and bipolar disorder (BPD). [provided by RefSeq]

NRG1: Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. The multiple isoforms perform diverse functions such as inducing growth and differentiation of epithelial, glial, neuronal, and skeletal muscle cells; inducing expression of acetylcholine receptor in synaptic vesicles during the formation of the neuromuscular junction; stimulating lobuloalveolar budding and milk production in the mammary gland and inducing differentiation of mammary tumor cells; stimulating Schwann cell proliferation; implication in the development of the myocardium such as trabeculation of the developing heart. Isoform 10 may play a role in motor and sensory neuron development. The cytoplasmic domain interacts with the LIM domain region of LIMK1. Interacts with ERBB3 and ERBB4. Type I isoforms are the predominant forms expressed in the endocardium. Isoform alpha is expressed in breast, ovary, testis, prostate, heart, skeletal muscle, lung, placenta liver, kidney, salivary gland, small intestine and brain, but not in uterus, stomach, pancreas, and spleen. Isoform 3 is the predominant form in mesenchymal cells and in non-neuronal organs, whereas isoform 6 is the major neuronal form. Isoform 8 is expressed in spinal cord and brain. Isoform 9 is the major form in skeletal muscle cells; in the nervous system it is expressed in spinal cord and brain. Also detected in adult heart, placenta, lung, liver, kidney, and pancreas. Isoform 10 is expressed in nervous system: spinal cord motor neurons, dorsal root ganglion neurons, and brain. Predominant isoform expressed in sensory and motor neurons. Not detected in adult heart, placenta, lung, liver, skeletal muscle, kidney, and pancreas. Not expressed in fetal lung, liver and kidney. Type IV isoforms are brain-specific. Belongs to the neuregulin family. 10 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral; Motility/polarity/chemotaxis; Ligand, receptor tyrosine kinase; Cell development/differentiation; Cytokine. Chromosomal Location of Human Ortholog: 8p12. Cellular Component: extracellular space; membrane; integral to plasma membrane; axon; apical plasma membrane; cytoplasm; extracellular region; neuromuscular junction; nucleus. Molecular Function: ErbB-2 class receptor binding; protein binding; transmembrane receptor protein tyrosine kinase activator activity; growth factor activity; ErbB-3 class receptor binding; transcription cofactor activity; cytokine activity; protein tyrosine kinase activator activity; receptor tyrosine kinase binding; receptor binding. Biological Process: regulation of protein heterodimerization activity; positive regulation of cell adhesion; transmembrane receptor protein tyrosine kinase activation (dimerization); nerve growth factor receptor signaling pathway; wound healing; cellular protein complex disassembly; neural crest cell development; cell morphogenesis; ventricular cardiac muscle cell differentiation; locomotory behavior; positive regulation of striated muscle cell differentiation; cardiac muscle cell differentiation; synaptogenesis; mammary gland development; cell communication; positive regulation of cardiac muscle cell proliferation; epidermal growth factor receptor signaling pathway; nervous system development; cell migration; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; neurotransmitter receptor metabolic process; regulation of protein homodimerization activity; MAPKKK cascade; neuron fate commitment; positive regulation of cell growth; peripheral nervous system development; positive regulation of protein kinase B signaling cascade; cell proliferation; embryonic development; glial cell fate commitment; innate immune response; negative regulation of secretion; positive regulation of Ras protein signal transduction; negative regulation of protein catabolic process; negative regulation of transcription, DNA-dependent; transmembrane receptor protein tyrosine kinase signaling pathway. Disease: Schizophrenia 6

0.01 mg

275 USD

0.05 mg

340