KCNJ15 (KCNJ14, ATP-sensitive Inward Rectifier Potassium Channel 15, Inward Rectifier K(+) Channel Kir1.3, Inward Rectifier K(+) Channel Kir4.2, Potassium Channel, Inwardly Rectifying Subfamily J Member 15, MGC13584) | MyBioSource MBS649976 product information

product summary

company name :

MyBioSource

product type :

antibody

product name :

KCNJ15 (KCNJ14, ATP-sensitive Inward Rectifier Potassium Channel 15, Inward Rectifier K(+) Channel Kir1.3, Inward Rectifier K(+) Channel Kir4.2, Potassium Channel, Inwardly Rectifying Subfamily J Member 15, MGC13584)

catalog :

MBS649976

quantity :

0.1 mg

price :

580 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

[1B2]

reactivity :

human, mouse

application :

western blot, ELISA, enzyme immunoassay

more info or order :

MyBioSource product webpage

image

image 1 :

Western Blot detection against Immunogen (33kD) using MBS649976.

image 2 :

Western Blot analysis of KCNJ15 expression in transfected 293T cell line using MBS649976. Lane 1: KCNJ15 transfected lysate (42.6kD). Lane 2: Non-transfected lysate.

image 3 :

Western Blot analysis of KCNJ15 over-expressed 293 cell line, cotransfected with KCNJ15 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MBS649976. GAPDH (36.1kD) used as specificity and loading control.

product information

catalog number :

MBS649976

products type :

Antibody

products full name :

products short name :

[KCNJ15]

products name syn :

[Anti -KCNJ15 (KCNJ14, ATP-sensitive Inward Rectifier Potassium Channel 15, Inward Rectifier K(+) Channel Kir1.3, Inward Rectifier K(+) Channel Kir4.2, Potassium Channel, Inwardly Rectifying Subfamily J Member 15, MGC13584)]

other names :

[Kcnj15 protein; ATP-sensitive inward rectifier potassium channel 15; ATP-sensitive inward rectifier potassium channel 15; inward rectifier K+ channel Kir4.2; potassium channel, inwardly rectifying subfamily J member 15; potassium inwardly-rectifying channel, subfamily J, member 15; Inward rectifier K(+) channel Kir4.2; Potassium channel, inwardly rectifying subfamily J member 15]

other gene names :

[Kcnj15; Kcnj15; IRKK; Kir4.2; AI182284; AI267127; 4930414N08Rik]

uniprot entry name :

IRK15_MOUSE

clonality :

Monoclonal

isotype :

IgG2a,k

clone :

[1B2]

host :

Mouse

reactivity :

Human

sequence :

TSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFS
QFEQIRKSPDCTFYCADSEKQQLEEKY

specificity :

Recognizes human KCNJ15.

purity :

Affinity Purified. Purified by Protein A affinity chromatography.

form :

Supplied as a liquid in PBS, pH 7.4.

concentration :

0.5mg/ml

storage stability :

May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

tested application :

ELISA (EL/EIA), Western Blot (WB)

app notes :

Suitable for use in ELISA and Western Blot. Other applications not tested. Optimal dilutions to be determined by the researcher.

image1 heading :

Western Blot (WB)

image2 heading :

Western Blot (WB)

image3 heading :

Western Blot (WB)

image4 heading :

Testing Data

image4 description :

Detection limit for recombinant GST tagged KCNJ15 is 3ng/ml using MBS649976 as a capture antibody.

other info1 :

Immunogen: Partial recombinant corresponding to aa290-355 from human KCNJ15 (NP_002234) with GST tag. MW of the GST tag alone is 26kD.

products categories :

Antibodies; Abs to Ion Channel

products description :

Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Three transcript variants encoding the same protein have been found for this gene.

ncbi gi num :

187951063

ncbi acc num :

NM_002243

uniprot acc num :

O88932

ncbi pathways :

Activation Of G Protein Gated Potassium Channels Pathway (820118); Activation Of GABAB Receptors Pathway (820109); G Protein Gated Potassium Channels Pathway (820117); GABA B Receptor Activation Pathway (820108); GABA Receptor Activation Pathway (820106); Gastric Acid Secretion Pathway (154411); Gastric Acid Secretion Pathway (154383); Inhibition Of Voltage Gated Ca2+ Channels Via Gbeta/gamma Subunits Pathway (820111); Inwardly Rectifying K+ Channels Pathway (820116); Neuronal System Pathway (820056)

uniprot summary :

Function: Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Subunit structure: Interacts with INADL . By similarity. Subcellular location: Membrane; Multi-pass membrane protein. Sequence similarities: Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ15 subfamily. [View classification]

size1 :

0.1 mg

price1 :

580 USD

more info or order :

MyBioSource product webpage