antibody

CSNK2A2 (Casein Kinase II Subunit alpha', CK II alpha', CK2A2)

MBS648418

0.1 mg

580 USD

monoclonal

mouse

nonconjugated

[1E8]

human, cow

western blot, ELISA, immunocytochemistry, enzyme immunoassay

Antibody

CSNK2A2 (Casein Kinase II Subunit alpha', CK II alpha', CK2A2)

[CSNK2A2]

[Anti -CSNK2A2 (Casein Kinase II Subunit alpha', CK II alpha', CK2A2)]

[casein kinase II subunit alpha'; Casein kinase II subunit alpha'; casein kinase II subunit alpha'; CK II alpha'; casein kinase 2, alpha prime polypeptide]

[CSNK2A2; CSNK2A2; CK II alpha']

CSK22_BOVIN

Monoclonal

IgG2a,k

[1E8]

Mouse

Human

MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDD
YQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKK
IKREVKILENLRGGTNIIKLID

Recognizes human CSNK2A2.

Purified. Purified by Protein A affinity chromatography.

Supplied as a liquid in PBS, pH 7.4

1mg/ml

May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)

Suitable for use in ELISA, Immunofluorescence and Western Blot.

Western Blot (WB)

Testing Data

Immunogen: Partial recombinant corresponding to aa1-100 from human CSNK2A2 (NP_001887.1) with GST tag. MW of the GST tag alone is 26kD.

Antibodies; Abs to Protein Kinases

Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation. With more than 500 gene products, the protein kinase family is one of the largest families of proteins in eukaryotes. The family has been classified in 8 major groups based on sequence comparison of their tyrosine (PTK) or serine/threonine (STK) kinase catalytic domains. The AGC kinase group consists of 63 kinases including the cyclic nucleotide-regulated protein kinase (PKA & PKG) family, the diacylglycerol-activated/phospholipid-dependent protein kinase C (PKC) family, the related to PKA and PKC (RAC/Akt) protein kinase family, the kinases that phosphorylate G protein-coupled receptors family (ARK), and the kinases that phosphorylate ribosomal protein S6 family (RSK).

27807145

NP_777061.1

NM_174636.2

P20427

41,270 Da

Adherens Junction Pathway (84309); Adherens Junction Pathway (481); Axon Guidance Pathway (826770); Cell Cycle Pathway (827959); Cell Cycle, Mitotic Pathway (827981); Condensation Of Prometaphase Chromosomes Pathway (828021); Developmental Biology Pathway (826769); Epstein-Barr Virus Infection Pathway (585566); Epstein-Barr Virus Infection Pathway (587115); Herpes Simplex Infection Pathway (377872)

Function: Catalytic subunit of a constitutively active serine/threonine-protein kinase complex that phosphorylates a large number of substrates containing acidic residues C-terminal to the phosphorylated serine or threonine. Regulates numerous cellular processes, such as cell cycle progression, apoptosis and transcription, as well as viral infection. May act as a regulatory node which integrates and coordinates numerous signals leading to an appropriate cellular response. During mitosis, functions as a component of the p53/TP53-dependent spindle assembly checkpoint (SAC) that maintains cyclin-B-CDK1 activity and G2 arrest in response to spindle damage. Also required for p53/TP53-mediated apoptosis, phosphorylating 'Ser-392' of p53/TP53 following UV irradiation. Can also negatively regulate apoptosis. Phosphorylates the caspases CASP9 and CASP2 and the apoptotic regulator NOL3. Phosphorylation protects CASP9 from cleavage and activation by CASP8, and inhibits the dimerization of CASP2 and activation of CASP8. Regulates transcription by direct phosphorylation of RNA polymerases I, II, III and IV. Also phosphorylates and regulates numerous transcription factors including NF-kappa-B, STAT1, CREB1, IRF1, IRF2, ATF1, SRF, MAX, JUN, FOS, MYC and MYB. Phosphorylates Hsp90 and its co-chaperones FKBP4 and CDC37, which is essential for chaperone function. Regulates Wnt signaling by phosphorylating CTNNB1 and the transcription factor LEF1. Acts as an ectokinase that phosphorylates several extracellular proteins . By similarity. Catalytic activity: ATP + a protein = ADP + a phosphoprotein. Enzyme regulation: Constitutively active protein kinase whose activity is not directly affected by phosphorylation. Seems to be regulated by level of expression and localization . By similarity. Subunit structure: Heterotetramer composed of two catalytic subunits (alpha chain and/or alpha' chain) and two regulatory subunits (beta chains). The tetramer can exist as a combination of 2 alpha/2 beta, 2 alpha'/2 beta or 1 alpha/1 alpha'/2 beta subunits. Also part of a CK2-SPT16-SSRP1 complex composed of SSRP1, SUPT16H, CSNK2A1, CSNK2A2 and CSNK2B, which forms following UV irradiation. Interacts with RNPS1 . By similarity. Miscellaneous: Can use both ATP and GTP as phosphoryl donors. Phosphorylation by casein kinase 2 has been estimated to represent up to one quarter of the eukaryotic phosphoproteome. Sequence similarities: Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. CK2 subfamily.Contains 1 protein kinase domain.

0.1 mg

580 USD