product summary
Loading...
company name :
MyBioSource
product type :
antibody
product name :
AKIP1 (BCA3, C11orf17, A-kinase-interacting Protein 1, Breast Cancer-associated Gene 3 Protein, PKA-interacting Protein, Proline-rich Protein BCA3)
catalog :
MBS644389
quantity :
0.1 mg
price :
580 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
[2B11]
reactivity :
human
application :
enzyme immunoassay
more info or order :
image
image 1 :
Western Blot detection against Immunogen (37.11kD).
product information
catalog number :
MBS644389
products type :
Antibody
products full name :
AKIP1 (BCA3, C11orf17, A-kinase-interacting Protein 1, Breast Cancer-associated Gene 3 Protein, PKA-interacting Protein, Proline-rich Protein BCA3)
products short name :
[AKIP1]
products name syn :
[Anti -AKIP1 (BCA3, C11orf17, A-kinase-interacting Protein 1, Breast Cancer-associated Gene 3 Protein, PKA-interacting Protein, Proline-rich Protein BCA3)]
other names :
[A-kinase-interacting protein 1 isoform d; A-kinase-interacting protein 1; A-kinase-interacting protein 1; koyt binding protein 1; koyt binding protein 2; koyt binding protein 3; proline-rich protein BCA3; breast cancer associated gene 3; A kinase (PRKA) interacting protein 1; Breast cancer-associated gene 3 protein; PKA-interacting protein; Proline-rich protein BCA3]
other gene names :
[AKIP1; AKIP1; BCA3; C11orf17; BCA3; C11orf17]
uniprot entry name :
AKIP1_HUMAN
clonality :
m
isotype :
IgG2a,k
clone :
[2B11]
host :
Mouse
reactivity :
Human
sequence :
GGATHVYRYHRGESKLHMCLDIGNGQRKDRKKTSLGPGG
SYQISEHAPEASQPAENISKDLYIEVYPGTYSVTVGSND
LTKKTHVVAVDSGQSVDLVFPV
SYQISEHAPEASQPAENISKDLYIEVYPGTYSVTVGSND
LTKKTHVVAVDSGQSVDLVFPV
specificity :
Recognizes human C11orf17.
purity :
Affinity Purified. Purified by Protein A affinity chromatography.
form :
Supplied as a liquid in PBS, pH 7.2.
concentration :
0.5mg
storage stability :
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
tested application :
ELISA (EL/EIA), Western Blot (WB). Other applications not tested.
app notes :
Recommended Dilution: . Optimal dilutions to be determined by the researcher.
image1 heading :
Western Blot (WB)
other info1 :
Immunogen: Partial recombinant corresponding to aa111-211 from human C11orf17 (NP_065693) with GST tag. MW of the GST tag alone is 26kD.
products categories :
Antibodies; Abs to Protein Kinases
products description :
C11orf17 is a nuclear protein and known to bind to the amino terminus (residues 1-39) of the C subunit of PKA. It is a binding partner of NF-kappaB p65 subunit, and enhances NF-kappaB-mediated gene expression.
ncbi gi num :
331284160
ncbi acc num :
NP_001193577.1
ncbi gb acc num :
NM_001206648.1
uniprot acc num :
Q9NQ31
ncbi mol weight :
23,114 Da
ncbi summary :
This gene encodes a nuclear protein that interacts with protein kinase A catalytic subunit, and regulates the effect of the cAMP-dependent protein kinase signaling pathway on the NF-kappa-B activation cascade. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Oct 2011]
uniprot summary :
BCA3: Enhances NF-kappa-B transcriptional activity by regulating the nuclear localization of the NF-kappa-B subunit RELA and promoting the phosphorylation of RELA by PRKACA. Regulates the effect of the cAMP-dependent protein kinase signaling pathway on the NF-kappa-B activation cascade. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Oncoprotein. Chromosomal Location of Human Ortholog: 11p15.3. Cellular Component: nucleoplasm. Molecular Function: protein binding
size1 :
0.1 mg
price1 :
580 USD
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!