SPANXB1 (Sperm Protein Associated with the Nucleus on the X Chromosome B/F, SPANX Family Member B/F, Cancer/testis Antigen 11.2, CT11.2, Nuclear-associated Protein SPAN-Xb, SPANXB, SPANX-B, SPANXB2, Nuclear-associated Protein SPAN-Xf, SPANX-F, SPANX | MyBioSource MBS644239 product information

product summary

company name :

MyBioSource

product type :

antibody

product name :

SPANXB1 (Sperm Protein Associated with the Nucleus on the X Chromosome B/F, SPANX Family Member B/F, Cancer/testis Antigen 11.2, CT11.2, Nuclear-associated Protein SPAN-Xb, SPANXB, SPANX-B, SPANXB2, Nuclear-associated Protein SPAN-Xf, SPANX-F, SPANX

catalog :

MBS644239

quantity :

0.2 mL

price :

580 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

[2E12]

reactivity :

human

application :

western blot, ELISA, enzyme immunoassay

more info or order :

MyBioSource product webpage

image

image 1 :

Western Blot detection against Immunogen (37.44kD).

product information

catalog number :

MBS644239

products type :

Antibody

products full name :

products short name :

[SPANXB1]

products name syn :

[Anti -SPANXB1 (Sperm Protein Associated with the Nucleus on the X Chromosome B/F, SPANX Family Member B/F, Cancer/testis Antigen 11.2, CT11.2, Nuclear-associated Protein SPAN-Xb, SPANXB, SPANX-B, SPANXB2, Nuclear-associated Protein SPAN-Xf, SPANX-F, SPANXF1)]

other names :

[sperm protein associated with the nucleus on the X chromosome B/F; Sperm protein associated with the nucleus on the X chromosome B/F; sperm protein associated with the nucleus on the X chromosome B/F; SPANX family member B/F; cancer/testis antigen 11.2; nuclear-associated protein SPAN-Xb; nuclear-associated protein SPAN-Xf; cancer/testis antigen family 11, member 2; sperm protein associated with the nucleus, X chromosome, family member B1; SPANX family, member B1; Cancer/testis antigen 11.2; CT11.2; Nuclear-associated protein SPAN-Xb; SPANX-B; Nuclear-associated protein SPAN-Xf; SPANX-F; SPANX family member B/F]

other gene names :

[SPANXB1; SPANXB1; B1; CT11.2; SPANXB; SPANX-B; SPANXB; CT11.2; SPANX-B; SPANX-F]

uniprot entry name :

SPNXB_HUMAN

clonality :

Monoclonal

isotype :

IgM,k

clone :

[2E12]

host :

Mouse

reactivity :

Human

sequence :

MGQQSSVRRLKRSVPCESNEANEANEANKTMPETPTGDS
DPQPAPKKMKTSESSTILVVRYRRNVKRTSPEELVNDHA
RENRINPDQMEEEEFIEITTERPKK*

specificity :

Recognizes human SPANXB1.

purity :

Ascites. Ascites

form :

Supplied as a liquid in ascites fluid.

storage stability :

May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

tested application :

ELISA (EL/EIA), Western Blot (WB)

app notes :

Suitable for use in ELISA and Western Blot.

image1 heading :

Western Blot (WB)

other info1 :

Immunogen: Full length recombinant protein corresponding to aa1-103 of human SPANXB1 (AAH34472) with GST tag. MW of the GST tag alone is 26kD.

products categories :

Antibodies; Abs to Cancer Markers

ncbi gi num :

14196344

ncbi acc num :

NP_115850.1

ncbi gb acc num :

NM_032461.2

uniprot acc num :

Q9NS25

ncbi mol weight :

11,826 Da

ncbi summary :

Temporally regulated transcription and translation of several testis-specific genes is required to initiate the series of molecular and morphological changes in the male germ cell lineage necessary for the formation of mature spermatozoa. This gene is a member of the SPANX family of cancer/testis-associated genes, which are located in a cluster on chromosome X. The SPANX genes encode differentially expressed testis-specific proteins that localize to various subcellular compartments. This particular gene maps to chromosome X in a head-to-tail orientation with SPANX family member B2, which appears to be a duplication of the B1 locus. The SPANXB genes are unique members of this gene family, since they contain an additional 18 nt in their coding region compared to the majority of family members. Although the protein encoded by this gene contains consensus nuclear localization signals, the major site for subcellular localization of expressed protein is in the cytoplasmic droplets of ejaculated spermatozoa. This protein provides a biochemical marker for studying the unique structures in spermatazoa, while attempting to further define its role in spermatogenesis. [provided by RefSeq, Jul 2008]

uniprot summary :

SPANXB1: Temporally regulated transcription and translation of several testis-specific genes is required to initiate the series of molecular and morphological changes in the male germ cell lineage necessary for the formation of mature spermatozoa. This gene is a member of the SPANX family of cancer/testis-associated genes, which are located in a cluster on chromosome X. The SPANX genes encode differentially expressed testis-specific proteins that localize to various subcellular compartments. This particular gene maps to chromosome X in a head-to-tail orientation with SPANX family member B2, which appears to be a duplication of the B1 locus. The SPANXB genes are unique members of this gene family, since they contain an additional 18 nt in their coding region compared to the majority of family members. Although the protein encoded by this gene contains consensus nuclear localization signals, the major site for subcellular localization of expressed protein is in the cytoplasmic droplets of ejaculated spermatozoa. This protein provides a biochemical marker for studying the unique structures in spermatazoa, while attempting to further define its role in spermatogenesis. [provided by RefSeq, Jul 2008]. Protein type: Cancer Testis Antigen (CTA). Chromosomal Location of Human Ortholog: Xq27.1. Cellular Component: cytoplasm; nucleus. Biological Process: spermatid development

size1 :

0.2 mL

price1 :

580 USD

more info or order :

MyBioSource product webpage