protein

Complement C5a des Arg, Recombinant Human

MBS637987

0.05 mg

820 USD

Recombinant Protein

Complement C5a des Arg, Recombinant Human

[Complement C5a des Arg Human]

[C5a anaphylatoxin chemotactic receptor 2; C5a anaphylatoxin chemotactic receptor 2; C5a anaphylatoxin chemotactic receptor 2; G protein-coupled receptor 77; G protein-coupled receptor C5L2; C5a anaphylatoxin chemotactic receptor C5L2; complement component 5a receptor 2; Complement component 5a receptor 2; G-protein coupled receptor 77]

[C5AR2; C5AR2; C5L2; GPF77; GPR77; C5L2; GPR77]

C5AR2_HUMAN

RAARISLGPRCIKAFTECCVVASQLRANISHKDMQLG
MRGSHHHHHHGSDYDIPTTENLYFQGGSTLQKKIEEIAA
KYKHSVVKKCCYDGACVNNDETCEQ.

Purified

Supplied as a lyophilized powder from 0.1M Tris-Cl, pH 8.0, 0.005% Tween 80, 2mM reduced L-glutathion, 0.2mM oxidized L-glutathion. Reconstitute with 500ul sterile ddH2O

~0.1mg/ml (after reconstitution)

Lyophilized powder may be stored at -20 degree C. Stable for 6 months after receipt at -20 degree C. Reconstitute with sterile ddH20. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Molecular Biology; MB-Complement

Complement fragment C5a is a 74-residu glycopolypeptide which is generated by proteol ic cleavage of the complement factor 5 In the course of complement activation. C5a is a potent chemoattractant and anaphylatoxin that acts on all classes of leukocytes and on many other cell types including endothelial, smooth muscle, kidney, liver, and neural cells. In addition to its proinflammatory effects, C5a has been shown to protect cells against toxic insult and to stimulate proliferation in neurons and hep'atocytes, suggesting .a wider role for C5a in homeostasis. C5a is rapidly desarginated by serum carboxypeptidase N to the less potent derivate C5a desArg the first stage in deactivation of anaphylatoxin activity. The C5a desArg form has a different spectrum of bioactiVity to intact C5a. Recombinant protein corresponding to human C5a desArg (6xHIS tag) expressed in E.coli.

415712997

NP_001258679.1

NM_001271750.1

Q9P296

Class A/1 (Rhodopsin-like Receptors) Pathway (106357); GPCR Ligand Binding Pathway (161020); GPCRs, Class A Rhodopsin-like Pathway (198886); GPCRs, Other Pathway (198765); Peptide Ligand-binding Receptors Pathway (106358); Signal Transduction Pathway (477114); Signaling By GPCR Pathway (106356)

This gene encodes a G-protein coupled receptor 1 family member involved in the complement system of the innate immune response. Unlike classical G-protein coupled receptors, the encoded protein does not associate with intracellular G-proteins. It may instead modulate signal transduction through the beta-arrestin pathway, and may alternatively act as a decoy receptor. This gene may be involved in coronary artery disease and in the pathogenesis of sepsis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012]

C5AR2: Receptor for the chemotactic and inflammatory C3a, C4a and C5a anaphylatoxin peptides and also for their dearginated forms ASP/C3adesArg, C4adesArg and C5adesArg respectively. Couples weakly to G(i)-mediated signaling pathways. Belongs to the G-protein coupled receptor 1 family. Protein type: Receptor, GPCR; Membrane protein, multi-pass; GPCR, family 1; Membrane protein, integral. Chromosomal Location of Human Ortholog: 19q13.33. Cellular Component: apical part of cell; basal plasma membrane; plasma membrane; integral to membrane. Molecular Function: protein binding; C5a anaphylatoxin receptor activity. Biological Process: G-protein coupled receptor protein signaling pathway; negative regulation of tumor necrosis factor production; chemotaxis; inflammatory response; positive regulation of epithelial cell proliferation

0.05 mg

820 USD