protein

Complement C5a, Recombinant Mouse

MBS636890

0.05 mg

820 USD

Recombinant Protein

Complement C5a, Recombinant Mouse

[Complement C5a Mouse]

[Complement component 5a receptor 1; C5a anaphylatoxin chemotactic receptor 1; C5a anaphylatoxin chemotactic receptor 1; C5a-R; C5a ligand; C5a anaphylatoxin receptor; complement component 5 receptor 1; complement component 5a receptor 1; C5a anaphylatoxin chemotactic receptor]

[C5AR1; C5AR1; C5A; C5AR; C5R1; CD88; C5AR; C5R1; C5a-R; C5aR]

C5AR1_HUMAN

E Coli

ARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR.
MRGSHHHHHHGSDYDIPTTENLYFQGGSNLHLLRQKIEE
QAAKYKHSVPKKCCYDGARVNFYETCEERV.

Purified

Supplied aa a lyophilized powder from 0.005% Tween80+2 mM reduced L-glutathion+0.2mM oxidised L-gluthation+0.1M Tris-CI buffer, pH 8.0. Reconstitute with 500uL sterile ddH20. Further dilute with PBS.

~0.176 mg/mL (after reconstitution)

Lyophilized and reconstituted products may be stored at -20°C. Stable for 6 months after receipt at -20°C.Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Molecular Biology; MB-Complement

C5a is a potent chemoattractant and anaphylatoxin that acts on all classes of leukocytes and on many other cell types including endothelial, smooth muscle, kidney, liver, and neural cells. In addition to its proinflammatory effects, C5a has been shown to protect cells against toxic insult and to stimulate proliferation in neurons and hepatocytes, suggesting a wider role for C5a in homeostasis. C5a is rapidly desarginated by serum carboxypeptidase N to the less potent derivate C5a desArg, the first stage in deactivation of anaphylatoxin activity. The C5a desArg form has a different spectrum of bioactivity to intact C5a. Recombinant corresponding to mouse C5a (6xHIS tag) expressed in E. coli.

14290436

AAH08982.1

P21730

12kD

Class A/1 (Rhodopsin-like Receptors) Pathway (106357); Complement And Coagulation Cascades Pathway (198880); Complement And Coagulation Cascades Pathway (83073); Complement And Coagulation Cascades Pathway (484); G Alpha (i) Signalling Events Pathway (119550); GPCR Downstream Signaling Pathway (119548); GPCR Ligand Binding Pathway (161020); Neuroactive Ligand-receptor Interaction Pathway (83053); Neuroactive Ligand-receptor Interaction Pathway (462); Peptide GPCRs Pathway (198897)

C5aR: a family 1 G-protein coupled receptor that stimulates the GTPase activity of Gi2. Receptor for the chemotactic and inflammatory complement factor C5a. Stimulates chemotaxis, granule enzyme release and superoxide anion production. Phosphorylated in response to C5a or after stimulation of cells with phorbol esters. Expressed on monocytes, granulocytes, dendritic cells, astrocytes and microglia. Protein type: Membrane protein, multi-pass; Membrane protein, integral; GPCR, family 1; Receptor, GPCR. Chromosomal Location of Human Ortholog: 19q13.3-q13.4. Cellular Component: cell surface; apical part of cell; basolateral plasma membrane; integral to plasma membrane; cytoplasmic membrane-bound vesicle; plasma membrane. Molecular Function: complement component C5a binding; complement component C5a receptor activity; C5a anaphylatoxin receptor activity. Biological Process: neutrophil chemotaxis; sensory perception of chemical stimulus; organ regeneration; activation of MAPK activity; apoptosis; response to lipopolysaccharide; signal transduction; chemotaxis; cell proliferation in hindbrain; mRNA transcription from RNA polymerase II promoter; defense response to Gram-positive bacterium; elevation of cytosolic calcium ion concentration; phospholipase C activation; response to peptidoglycan; cellular defense response; immune response; negative regulation of neuron apoptosis; inflammatory response; positive regulation of epithelial cell proliferation

0.05 mg

820 USD