KVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGP
LPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFK
WERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPS
DGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDG
GHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYT
IVEQYERAEGRHSTGGMDELYK

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Phosphodiesterase 5A, Recombinant, Mouse (Phosphodiesterase 5A cGMP-specific, PD ...
- MutS, Recombinant, E. coli. Molecular Biology Grade | MBS635617
- HIV-1 gag, p24, Strain IIIB, Recombinant (Human Immunodeficiency Virus-1) (Bioti ...
- APRIL, soluble (H98), Recombinant, Human (ACRP30headless:APRIL, ACRP30headless:C ...
- Ro-60/SS-A Antigen (60kD), Recombinant, Human (SSA1, Sjogren Syndrome Antigen A1 ...