product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
mCherry Fluorescent Protein, Recombinant
catalog :
MBS635577
quantity :
0.1 mg
price :
585 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS635577
products type :
Recombinant Protein
products full name :
mCherry Fluorescent Protein, Recombinant
products short name :
[mCherry Fluorescent Protein]
other names :
[mCherry fluorescent protein, partial]
host :
E.Coli
sequence :
MGSSHHHHHHSSGLVPRGSHMVSKGEEDNMAIIKEFMRF
KVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGP
LPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFK
WERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPS
DGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDG
GHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYT
IVEQYERAEGRHSTGGMDELYK
purity :
> or = 97% (SDS-PAGE and HPLC).
form :
Supplied as freeze dried powder. Reconstitute with 100ul sterile ddH2O.
concentration :
~1mg/ml (after reconstitution)
storage stability :
Lyophilized powder may be stored at -70 degree C. Stable for 12 months at -70 degree C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -70 degree C. Aliquot to avoid repeated freezing and thawing and store at -70 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
tested application :
Western Blot (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunofluorescence (IF)
app notes :
Suitable for use as standard/positive control for SDS-PAGE and for Western Blot analysis of mCherry-transfected cells. Suitable for use in labeling proteins or antibodies. Also suitable for use in calibration of fluorometers and flow cytometers, and fluorescence microscope. mCherry protein can be microinjected into cells and tissues and is also ideal for fuison tag applications. Can be used for triple labeling with EGFP, CFP, YFP and other dyes. The 6xHis-Tag on the N-terminal can be used in Western Blot detection with 6xHis-Tag antibodies. The 6xHis-Tag can also be used in removal or purification of the mCherry protein. Other applications not tested.
other info2 :
Grade: Highly Purified. Endotoxin: < or =0.1ng/ug
products categories :
BioSeparation; BioSep-Assay Detection, Tags
products description :
mCherry is the second generation monomeric red fluorescent protein that have improved brightness and photostability. The recombinant mCherry is expressed and purified from transformed E. coli using a method that ensures high purity and maximal fluorescence intensity. The protein is a 28.8kD monomer with 256 amino acids, pI: 6.23. Ex.= 587 nm (540-590 nm); Em.= 610 nm (550-650 nm). The protein is engineered with 6xHis-tag on the N-terminus, which can be used for detection with anti-His-Tag antibody or protein purification/removal by using Ni++ beads.
ncbi gi num :
378532224
ncbi acc num :
AFC17497.1
ncbi mol weight :
28.8kD
size1 :
0.1 mg
price1 :
585 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!