product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Green Fluorescent Protein, Enhanced (Aequorea Victoria) (GFP)
catalog :
MBS634327
quantity :
0.1 mg
price :
490 USD
more info or order :
product information
catalog number :
MBS634327
products type :
Protein
products full name :
Green Fluorescent Protein, Enhanced (Aequorea Victoria) (GFP)
products short name :
Green Fluorescent Protein, Enhanced
other names :
Green fluorescent protein
host :
E Coli
sequence :
MVLLEFVTAAGITLGMDELYK
GEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKL
TLK
Histidine-V5 epitope fused to EGFP MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDHPFTVSK
purity :
Highly Purified. 92% by SDS-PAGE
form :
Supplied as a lyophilized powder. Reconstitute with 100ul sterile ddH2O.
concentration :
~1mg/ml (after reconstitution)
storage stability :
Lyophilized powder may be stored at -20 degree C. Stable for 12 months at -20 degree C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
products categories :
BioSeparation; BioSep-Assay Detection, Tags
products description :
Energy-transfer acceptor. Its role is to transduce the blue chemiluminescence of the protein aequorin into green fluorescent light by energy transfer. Fluoresces in vivo upon receiving energy from the Ca(2+)-activated photoprotein aequorin. Fluorescent proteins have become a useful and ubiquitous tool for making chimeric proteins, where they function as a fluorescent protein tag. Typically they tolerate N- and C-terminal fusion to a broad variety of proteins. They have been expressed in most known cell types and are used as a noninvasive fluorescent marker in living cells and organisms. They enable a wide range of applications where they have functioned as a cell lineage tracer, reporter of gene expression, or as a measure of protein-protein interactions.
ncbi gi num :
1169893
ncbi acc num :
P42212.1
ncbi mol weight :
~30kD
size1 :
0.1 mg
price1 :
490 USD
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!