catalog number :
MBS634327
products full name :
Green Fluorescent Protein, Enhanced (Aequorea Victoria) (GFP)
products short name :
Green Fluorescent Protein, Enhanced
other names :
Green fluorescent protein
sequence :
MVLLEFVTAAGITLGMDELYK
GEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKL
TLK
Histidine-V5 epitope fused to EGFP MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDHPFTVSK
purity :
Highly Purified. 92% by SDS-PAGE
form :
Supplied as a lyophilized powder. Reconstitute with 100ul sterile ddH2O.
concentration :
~1mg/ml (after reconstitution)
storage stability :
Lyophilized powder may be stored at -20 degree C. Stable for 12 months at -20 degree C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
products categories :
BioSeparation; BioSep-Assay Detection, Tags
products description :
Energy-transfer acceptor. Its role is to transduce the blue chemiluminescence of the protein aequorin into green fluorescent light by energy transfer. Fluoresces in vivo upon receiving energy from the Ca(2+)-activated photoprotein aequorin. Fluorescent proteins have become a useful and ubiquitous tool for making chimeric proteins, where they function as a fluorescent protein tag. Typically they tolerate N- and C-terminal fusion to a broad variety of proteins. They have been expressed in most known cell types and are used as a noninvasive fluorescent marker in living cells and organisms. They enable a wide range of applications where they have functioned as a cell lineage tracer, reporter of gene expression, or as a measure of protein-protein interactions.