NDST1 (Bifunctional Heparan Sulfate N-deacetylase/N-sulfotransferase 1, Glucosaminyl N-deacetylase/N-sulfotransferase 1, NDST-1, [Heparan Sulfate]-Glucosamine N-sulfotransferase 1, HSNST 1, N-heparan Sulfate Sulfotransferase 1, N-HSST 1, HSST, HSST1 | MyBioSource MBS631678 product information

product summary

company name :

MyBioSource

product type :

antibody

product name :

NDST1 (Bifunctional Heparan Sulfate N-deacetylase/N-sulfotransferase 1, Glucosaminyl N-deacetylase/N-sulfotransferase 1, NDST-1, [Heparan Sulfate]-Glucosamine N-sulfotransferase 1, HSNST 1, N-heparan Sulfate Sulfotransferase 1, N-HSST 1, HSST, HSST1

catalog :

MBS631678

quantity :

0.1 mg

price :

580 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

[11C463]

reactivity :

human

application :

western blot, ELISA, immunohistochemistry, enzyme immunoassay

more info or order :

MyBioSource product webpage

image

image 1 :

Detection limit for MBS631678 is ~0.03ng/ml as a capture antibody.

image 2 :

Western Blot analysis of NDST1 expression in A-549 using MBS631678.

image 3 :

Immunoperoxidase on formalin-fixed paraffin-embedded human small Intestine using MBS631678 (3ug/ml).

product information

catalog number :

MBS631678

products type :

Antibody

products full name :

products short name :

[NDST1]

products name syn :

[Anti -NDST1 (Bifunctional Heparan Sulfate N-deacetylase/N-sulfotransferase 1, Glucosaminyl N-deacetylase/N-sulfotransferase 1, NDST-1, [Heparan Sulfate]-Glucosamine N-sulfotransferase 1, HSNST 1, N-heparan Sulfate Sulfotransferase 1, N-HSST 1, HSST, HSST1) (Azi]

other names :

[NDST1 protein; Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1; bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1; NDST-1; HSNST 1; N-HSST 1; OTTHUMP00000224347; OTTHUMP00000224348; N-heparan sulfate sulfotransferase 1; glucosaminyl N-deacetylase/N-sulfotransferase 1; heparan sulfate-N-deacetylase/N-sulfotransferase; [Heparan sulfate]-glucosamine N-sulfotransferase 1; N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1; Glucosaminyl N-deacetylase/N-sulfotransferase 1; NDST-1; N-heparan sulfate sulfotransferase 1; N-HSST 1; [Heparan sulfate]-glucosamine N-sulfotransferase 1]

other gene names :

[NDST1; NDST1; HSST; NST1; HSST; HSST1]

uniprot entry name :

NDST1_HUMAN

clonality :

Monoclonal

isotype :

IgG2a,k

clone :

[11C463]

host :

Mouse

reactivity :

Human

sequence :

LYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAA
TPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEI
APGKGDMPTLTDKGRGRFALI

specificity :

Recognizes human NDST1.

purity :

Purified. Purified by ammonium sulfate precipitation.

form :

Supplied as a liquid in PBS, pH 7.4. No preservative added

concentration :

0.5 mg/ml

storage stability :

May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

tested application :

ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)

app notes :

Suitable for use in ELISA, Immunohistochemistry and Western Blot. Immunohistochemistry (Formalin-fixed, paraffin-embedded): 3ug/ml. Optimal dilutions to be determined by the researcher.

image1 heading :

Testing Data

image2 heading :

Western Blot (WB)

image3 heading :

Immunohistochemistry (IHC)

other info1 :

Immunogen: Partial recombinant protein corresponding to aa38-136 of human NDST1 (NP_001534) with GST tag. MW of the GST tag alone is 26kD.

other info2 :

Positive Control: Human small intestine, A549 cells.

products categories :

Antibodies; Abs to Enzymes, Sulfotransferase

products description :

NDST1 is an essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA dissacharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. Plays a role in determining the extent and pattern of sulfation of heparan sulfate. Compared to other NDST enzymes, its presence is absolutely required. Participates in biosynthesis of heparan sulfate that can ultimately serve as L-selectin ligands, thereby playing a role in inflammatory response.

ncbi gi num :

15277597

uniprot acc num :

P52848

ncbi pathways :

Glycosaminoglycan Biosynthesis - Heparan Sulfate Pathway (82984); Glycosaminoglycan Biosynthesis - Heparan Sulfate Pathway (358); Metabolic Pathways (132956)

ncbi summary :

This gene encodes a member of the heparan sulfate/heparin GlcNAc N-deacetylase/ N-sulfotransferase family. The encoded enzyme is a type II transmembrane protein that resides in the Golgi apparatus. The encoded protein catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate to nitrogen of glucosamine in heparan sulfate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014]

uniprot summary :

NDST1: Essential bifunctional enzyme that catalyzes both the N- deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA disaccharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. Plays a role in determining the extent and pattern of sulfation of heparan sulfate. Compared to other NDST enzymes, its presence is absolutely required. Participates in biosynthesis of heparan sulfate that can ultimately serve as L- selectin ligands, thereby playing a role in inflammatory response. Belongs to the sulfotransferase 1 family. NDST subfamily. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral; Transferase; Glycan Metabolism - heparan sulfate biosynthesis; Hydrolase; EC 2.8.2.8. Chromosomal Location of Human Ortholog: 5q33.1. Cellular Component: Golgi membrane; integral to membrane. Molecular Function: deacetylase activity; [heparan sulfate]-glucosamine N-sulfotransferase activity. Biological Process: smoothened signaling pathway; fibroblast growth factor receptor signaling pathway; glycosaminoglycan metabolic process; MAPKKK cascade; pathogenesis; embryonic viscerocranium morphogenesis; respiratory gaseous exchange; polysaccharide biosynthetic process; glycosaminoglycan biosynthetic process; heparin biosynthetic process; heparan sulfate proteoglycan biosynthetic process; forebrain development; carbohydrate metabolic process; midbrain development; embryonic neurocranium morphogenesis; inflammatory response. Disease: Mental Retardation, Autosomal Recessive 46

size1 :

0.1 mg

price1 :

580 USD

more info or order :

MyBioSource product webpage