TQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANV
VNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSP
QNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVH
LDRII

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Complement C3, C3c (Complement Component C3c, C3/C3c, Acylation Stimulating Prot ...
- HIV-1 gp120, Strain IIIB (Human Immunodeficiency Virus Type 1) (FITC) | MBS632531
- Troponin I, Cardiac, aa27-39 (cTnI, CMH7, Familial Hypertrophic Cardiomyopathy 7 ...
- FUCA1 (Alpha-L-fucosidase 1, Alpha-L-fucosidase I, Alpha-L-fucoside Fucohydrolas ...
- Adrenocorticotrophic Hormone (ACTH, Corticotropin, Corticotropin-like Intermedia ...