catalog number :
MBS628068
products full name :
TUFM (Elongation Factor Tu, Mitochondrial, EF-Tu, P43)
products short name :
[TUFM]
products name syn :
[Anti -TUFM (Elongation Factor Tu, Mitochondrial, EF-Tu, P43)]
other names :
[Tufm protein; Elongation factor Tu, mitochondrial; elongation factor Tu, mitochondrial; Tu translation elongation factor, mitochondrial]
other gene names :
[Tufm; Tufm; EFTU; C76308; C76389; EF-TuMT; 2300002G02Rik]
uniprot entry name :
EFTU_MOUSE
sequence :
MTTMAAATLLRATPHFSGLAAGRTFLLQGLLRLLKAPAL
PLLCRGLAVEAKKTYVRDKPHVNVGTIGHVDHGKTTLTA
AITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVE
YSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAA
NDGPMPQTREHLLLARQIGVEHVVVYVNKADAVQDSEMV
ELVELEIRELLTEFGYKGEETPVIVGSALCALEGRDPEL
GLKSVQKLLDAVDTYIPVPARDLEKPFLLPVEAVYSVPG
RGTVVTGTLERGILKKGDECELLGHSKNIRTVVTGIEMF
HKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSIKP
HQKVEAQVYILSKEEGGRHKPFVSHFMPVMFSLTWDMAC
RIILPPEKELAMPGEDLKFNLILRQPMILEKGQRFTLRD
GNRTIGTGLVTNTLAMTEEEKNIKWG
specificity :
Recognizes human TUFM.
form :
Supplied as a liquid in PBS, pH 7.4
concentration :
0.5 mg/mL
storage stability :
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
tested application :
Suitable for use in Western Blot and Immunofluorescence. Other applications not tested.
app notes :
Immunofluorescence: 10 ug/mL. Optimal dilutions to be determined by the researcher.
image1 heading :
Western Blot (WB)
image2 heading :
Western Blot (WB)
image3 heading :
Western Blot (WB)
image4 heading :
Immunofluorescence (IF)
image4 description :
Immunofluorescence of MBS628068 (10ug/ml) on HeLa cell.
other info1 :
Immunogen: Full-length protein corresponding to aa1-455 from human TUFM.
products categories :
Antibodies; Abs to Proteins
products description :
TUFM is a protein which participates in protein translation in mitochondria. This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.
ncbi acc num :
NP_003312.3
uniprot summary :
EFTU: This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis. Defects in TUFM are the cause of combined oxidative phosphorylation deficiency type 4 (COXPD4). COXPD4 is characterized by neonatal lactic acidosis, rapidly progressive encephalopathy, severely decreased mitochondrial protein synthesis, and combined deficiency of mtDNA-related mitochondrial respiratory chain complexes. Belongs to the GTP-binding elongation factor family. EF-Tu/EF-1A subfamily. Protein type: Mitochondrial; Translation elongation; Translation; RNA-binding. Cellular Component: membrane; mitochondrion; mitochondrial inner membrane; intracellular; myelin sheath. Molecular Function: GTPase activity; GTP binding; nucleotide binding; translation elongation factor activity. Biological Process: translational elongation; translation