product summary
Loading...
company name :
MyBioSource
product type :
antibody
product name :
FOLR2 (Folate Receptor beta, FR-beta, Folate Receptor 2 Folate Receptor, Fetal/Placental Placental Folate-binding Protein, FBP)
catalog :
MBS609209
quantity :
0.1 mg
price :
505 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4B12
reactivity :
human
application :
western blot, ELISA, enzyme immunoassay
more info or order :
product information
catalog number :
MBS609209
products type :
Antibody
products full name :
FOLR2 (Folate Receptor beta, FR-beta, Folate Receptor 2 Folate Receptor, Fetal/Placental Placental Folate-binding Protein, FBP)
products short name :
FOLR2
products name syn :
Anti -FOLR2 (Folate Receptor beta, FR-beta, Folate Receptor 2 Folate Receptor, Fetal/Placental Placental Folate-binding Protein, FBP)
other names :
folate receptor beta; Folate receptor beta; folate receptor beta; folate receptor, beta; folate receptor, fetal/placental; placental folate-binding protein; folate-binding protein, fetal/placental; folate receptor 2 (fetal); Folate receptor 2; Folate receptor, fetal/placental; Placental folate-binding protein
other gene names :
FOLR2; FOLR2; FBP; FR-P3; FR-BETA; BETA-HFR; FBP/PL-1; FR-beta; FBP
uniprot entry name :
FOLR2_HUMAN
clonality :
Monoclonal
isotype :
IgG2a
clone :
4B12
host :
Host: Mouse; Source: Human
reactivity :
Human
sequence :
HHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSR
LYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQ
VNQTWRKERFLDVPL*
specificity :
Recognizes human FOLR2.
purity :
Purified. Purified
form :
Supplied as a liquid in PBS, pH 7.2.
storage stability :
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
tested application :
ELISA (EL/EIA), Western Blot (WB)
app notes :
Suitable for use in ELISA and Western Blot. Dilution: Sandwich ELISA: 1-5ug/ml using recombinant protein. The detetion limit for recombinant GST tagged FOLR2 is ~1ng/ml. Western Blot: 1-5ug/ml. Detects a band at ~36.34kD using immunogen protein lysate.
other info1 :
Immunogen: Partial recombinant protein corresponding to aa 36-129 from FOLR2 (NP_000794) with GST tag. MW of the GST tag alone is 26kD.
products categories :
Antibodies; Abs to Receptors
products description :
The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and they mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This protein has a 68% and 79% sequence homology with the FOLR1 and FOLR3 proteins, respectively. Although this protein was originally thought to be specific to placenta, it can also exist in other tissues, and it may play a role in the transport of methotrexate in synovial macrophages in rheumatoid arthritis patients. Multiple transcript variants that encode the same protein have been found for this gene.
ncbi gi num :
166064054
ncbi acc num :
NP_001107007.1
ncbi gb acc num :
NM_001113535.1
uniprot acc num :
P14207
ncbi mol weight :
29,280 Da
ncbi pathways :
Endocytosis Pathway 102279!!Endocytosis Pathway 102181
ncbi summary :
The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and they mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This protein has a 68% and 79% sequence homology with the FOLR1 and FOLR3 proteins, respectively. Although this protein was originally thought to be specific to placenta, it can also exist in other tissues, and it may play a role in the transport of methotrexate in synovial macrophages in rheumatoid arthritis patients. Multiple transcript variants that encode the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
uniprot summary :
Function: Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. Subcellular location: Cell membrane; Lipid-anchor GPI-anchor. Secreted . Probable Ref.5. Tissue specificity: Expressed in placenta and hematopoietic cells. Expression is increased in malignant tissues. Post-translational modification: N-glycosylated. Sequence similarities: Belongs to the folate receptor family.
size :
0.1 mg
price :
505 USD
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!