catalog number :
MBS609209
products full name :
FOLR2 (Folate Receptor beta, FR-beta, Folate Receptor 2 Folate Receptor, Fetal/Placental Placental Folate-binding Protein, FBP)
products short name :
FOLR2
products name syn :
Anti -FOLR2 (Folate Receptor beta, FR-beta, Folate Receptor 2 Folate Receptor, Fetal/Placental Placental Folate-binding Protein, FBP)
other names :
folate receptor beta; Folate receptor beta; folate receptor beta; folate receptor, beta; folate receptor, fetal/placental; placental folate-binding protein; folate-binding protein, fetal/placental; folate receptor 2 (fetal); Folate receptor 2; Folate receptor, fetal/placental; Placental folate-binding protein
other gene names :
FOLR2; FOLR2; FBP; FR-P3; FR-BETA; BETA-HFR; FBP/PL-1; FR-beta; FBP
uniprot entry name :
FOLR2_HUMAN
host :
Host: Mouse; Source: Human
sequence :
HHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSR
LYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQ
VNQTWRKERFLDVPL*
specificity :
Recognizes human FOLR2.
purity :
Purified. Purified
form :
Supplied as a liquid in PBS, pH 7.2.
storage stability :
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
tested application :
ELISA (EL/EIA), Western Blot (WB)
app notes :
Suitable for use in ELISA and Western Blot. Dilution: Sandwich ELISA: 1-5ug/ml using recombinant protein. The detetion limit for recombinant GST tagged FOLR2 is ~1ng/ml. Western Blot: 1-5ug/ml. Detects a band at ~36.34kD using immunogen protein lysate.
other info1 :
Immunogen: Partial recombinant protein corresponding to aa 36-129 from FOLR2 (NP_000794) with GST tag. MW of the GST tag alone is 26kD.
products categories :
Antibodies; Abs to Receptors
products description :
The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and they mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This protein has a 68% and 79% sequence homology with the FOLR1 and FOLR3 proteins, respectively. Although this protein was originally thought to be specific to placenta, it can also exist in other tissues, and it may play a role in the transport of methotrexate in synovial macrophages in rheumatoid arthritis patients. Multiple transcript variants that encode the same protein have been found for this gene.
ncbi acc num :
NP_001107007.1
ncbi gb acc num :
NM_001113535.1
ncbi mol weight :
29,280 Da
ncbi pathways :
Endocytosis Pathway 102279!!Endocytosis Pathway 102181
ncbi summary :
The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and they mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This protein has a 68% and 79% sequence homology with the FOLR1 and FOLR3 proteins, respectively. Although this protein was originally thought to be specific to placenta, it can also exist in other tissues, and it may play a role in the transport of methotrexate in synovial macrophages in rheumatoid arthritis patients. Multiple transcript variants that encode the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
uniprot summary :
Function: Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. Subcellular location: Cell membrane; Lipid-anchor GPI-anchor. Secreted . Probable Ref.5. Tissue specificity: Expressed in placenta and hematopoietic cells. Expression is increased in malignant tissues. Post-translational modification: N-glycosylated. Sequence similarities: Belongs to the folate receptor family.