catalog number :
MBS6013316
products full name :
NAA60 (NAT15, HAT4, N-alpha-acetyltransferase 60, Histone Acetyltransferase Type B Protein 4, N-acetyltransferase 15, NatF Catalytic Subunit, FLJ14154, UNQ2771/PRO7155, FLJ11693)
products short name :
[NAA60]
products name syn :
[Anti -NAA60 (NAT15, HAT4, N-alpha-acetyltransferase 60, Histone Acetyltransferase Type B Protein 4, N-acetyltransferase 15, NatF Catalytic Subunit, FLJ14154, UNQ2771/PRO7155, FLJ11693)]
other names :
[N-alpha-acetyltransferase 60; N-alpha-acetyltransferase 60; N-alpha-acetyltransferase 60; natF catalytic subunit; histone acetyltransferase type B protein 4; N-acetyltransferase 15 (GCN5-related, putative); N(alpha)-acetyltransferase 60, NatF catalytic subunit; Histone acetyltransferase type B protein 4; HAT4; N-acetyltransferase 15; NatF catalytic subunit]
other gene names :
[NAA60; NAA60; HAT4; NAT15; HAT4; NAT15; HAT4]
uniprot entry name :
NAA60_HUMAN
sequence :
MTEVVPSSALSEVSLRLLCHDDIDTVKHLCGDWFPIEYP
DSWYRDITSNKKFFSLAATYRGAIVGMIVAEIKNRTKIH
KEDGDILASNFSVDTQVAYILSLGVVKEFRKHGIGSLLL
ESLKDHISTTAQDHCKAIYLHVLTTNNTAINFYENRDFK
QHHYLPYYYSIRGVLKDGFTYVLYINGGHPPWTILDYIQ
HLGSALASLSPCSIPHRVYRQAHSLLCSFLPWSGISSKS
GIEYSRTM
specificity :
Recognizes human NAA60.
purity :
Affinity Purified. Purified by Protein A affinity chromatography.
form :
Supplied as a liquid in PBS, pH 7.2.
storage stability :
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
tested application :
Western Blot (WB)
app notes :
Suitable for use in Western Blot.
image1 heading :
Western Blot (WB)
other info1 :
Immunogen: Full length protein corresponding to aa1-242 from human NAA60 NM_024845, NP_079121
products categories :
Antibodies; Abs to Enzymes, Acetyltransferase
products description :
Histone acetyltransferase localized in the Golgi apparatus that mediates acetylation of free histone H4, thereby facilitating nucleosome assembly. Has a preference for free histone H4 'Lys-20'(H4K20ac), 'Lys-79'(H4K79ac) and 'Lys-91' (H4K91ac). Also displays alpha (N-terminal) acetyltransferase activity towards a range of N-terminal sequences including those starting with Met-Lys, Met-Val, Met-Ala and Met-Met. Required for normal chromosomal segregation during anaphase.
ncbi acc num :
NP_001077070.1
ncbi gb acc num :
NM_001083601.1
ncbi mol weight :
27,451 Da
uniprot summary :
NAT15: Histone acetyltransferase localized in the Golgi apparatus that mediates acetylation of free histone H4, thereby facilitating nucleosome assembly. Has a preference for free histone H4 Lys-20 (H4K20ac), Lys-79 (H4K79ac) and Lys-91 (H4K91ac). Also displays alpha (N-terminal) acetyltransferase activity towards a range of N-terminal sequences including those starting with Met-Lys, Met-Val, Met-Ala and Met-Met. Required for normal chromosomal segregation during anaphase. Belongs to the acetyltransferase family. NAA60 subfamily. 5 isoforms of the human protein are produced by alternative promoter. Protein type: Acetyltransferase; EC 2.3.1.48; EC 2.3.1.88. Chromosomal Location of Human Ortholog: 16p13.3. Cellular Component: Golgi membrane. Molecular Function: peptide alpha-N-acetyltransferase activity; H4 histone acetyltransferase activity. Biological Process: cell proliferation; nucleosome assembly; N-terminal peptidyl-methionine acetylation; chromosome segregation