catalog number :
MBS6010259
products full name :
MRGPRX2 (MRGX2, Mas-related G-protein Coupled Receptor Member X2)
products short name :
[MRGPRX2]
products name syn :
[Anti -MRGPRX2 (MRGX2, Mas-related G-protein Coupled Receptor Member X2)]
other names :
[mas-related G-protein coupled receptor member X2; Mas-related G-protein coupled receptor member X2; mas-related G-protein coupled receptor member X2; G protein-coupled receptor MRGX2; MAS-related GPR, member X2]
other gene names :
[MRGPRX2; MRGPRX2; MRGX2; MRGX2]
uniprot entry name :
MRGX2_HUMAN
sequence :
MDPTTPAWGTESTTVNGNDQALLLLCGKETLIPVFLILF
IALVGLVGNGFVLWLLGFRMRRNAFSVYVLSLAGADFLF
LCFQIINCLVYLSNFFCSISINFPSFFTTVMTCAYLAGL
SMLSTVSTERCLSVLWPIWYRCRRPRHLSAVVCVLLWAL
SLLLSILEGKFCGFLFSDGDSGWCQTFDFITAAWLIFLF
MVLCGSSLALLVRILCGSRGLPLTRLYLTILLTVLVFLL
CGLPFGIQWFLILWIWKDSDVLFCHIHPVSVVLSSLNSS
ANPIIYFFVGSFRKQWRLQQPILKLALQRALQDIAEVDH
SEGCFRQGTPEMSRSSLV
specificity :
Recognizes human MRGPRX2.
purity :
Purified by Protein A affinity chromatography.
form :
Supplied as a liquid in PBS, pH 7.4.
concentration :
0.36mg/ml
storage stability :
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
tested application :
Western Blot (WB), Flow Cytometry (FC)
app notes :
Suitable for use in Western Blot and Flow Cytometry. Other applications not tested. Optimal dilutions to be determined by the researcher.
image1 heading :
Western Blot (WB)
image2 heading :
Flow Cytometry (FC/FACS)
other info1 :
Immunogen: Full length human MRGPRX2, aa1-330 (NP_473371.1).
products categories :
Antibodies; Abs to G Protein Receptors
products description :
MRGPRX2 is the orphan receptor. Probably involved in the function of nociceptive neurons. May regulate nociceptor function and/or development, including the sensation or modulation of pain. Cortistatin-14 seems to be a high potency ligand at this receptor. Cortistatin has several biological functions including roles in sleep regulation locomotor activity, and cortical function. In receptor-expressing cells, cortistatin-stimulated increases in intracellular Ca(2+) but had no effect on basal or forskolin-stimulated cAMP levels, suggesting that this receptor is G(q)-coupled.
ncbi acc num :
NP_473371.1
ncbi gb acc num :
NM_054030.2
uniprot summary :
MRGPRX2: Orphan receptor. Probably involved in the function of nociceptive neurons. May regulate nociceptor function and/or development, including the sensation or modulation of pain. Cortistatin-14 seems to be a high potency ligand at this receptor. Cortistatin has several biological functions including roles in sleep regulation locomotor activity, and cortical function. In receptor-expressing cells, cortistatin-stimulated increases in intracellular Ca(2+) but had no effect on basal or forskolin- stimulated cAMP levels, suggesting that this receptor is G(q)- coupled. Belongs to the G-protein coupled receptor 1 family. Mas subfamily. Protein type: Membrane protein, multi-pass; GPCR, family 1; Receptor, GPCR; Membrane protein, integral. Chromosomal Location of Human Ortholog: 11p15.1. Cellular Component: integral to membrane; plasma membrane. Molecular Function: G-protein coupled receptor activity; neuropeptide binding. Biological Process: positive regulation of cytokinesis; G-protein coupled receptor protein signaling pathway; sensory perception of pain; sleep