catalog number :
MBS6008404
products full name :
SLAMF7 (CS1, SLAM Family Member 7, CD2 Subset 1, CD2-like Receptor-activating Cytotoxic Cells, CRACC, Membrane Protein FOAP-12, Novel Ly9, Protein 19A, CD319, UNQ576/PRO1138)
products short name :
SLAMF7
products name syn :
Anti -SLAMF7 (CS1, SLAM Family Member 7, CD2 Subset 1, CD2-like Receptor-activating Cytotoxic Cells, CRACC, Membrane Protein FOAP-12, Novel Ly9, Protein 19A, CD319, UNQ576/PRO1138)
other names :
SLAM family member 7 isoform g; SLAM family member 7; SLAM family member 7; protein 19A; CD2 subset 1; 19A24 protein; membrane protein FOAP-12; CD2-like receptor activating cytotoxic cells; CD2-like receptor-activating cytotoxic cells; novel LY9 (lymphocyte antigen 9) like protein; SLAM family member 7; CD2 subset 1; CD2-like receptor-activating cytotoxic cells; CRACC; Membrane protein FOAP-12; Novel Ly9; Protein 19A
other gene names :
SLAMF7; SLAMF7; 19A; CS1; CD319; CRACC; CS1; CRACC
uniprot entry name :
SLAF7_HUMAN
sequence :
MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTF
PLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNR
ERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPST
QEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHG
EEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFIC
VARNPVSRNFSSPILARKLCEGAADDPDSSMVLLCLPLV
PLLLSLFVLGLFLWFLKRERQEENNPKGRSSKYGLLHCG
NTEKDGKSPLTAHDARHTKAICL
specificity :
Recognizes human SLAMF7 on transfected 293T cell line.
purity :
Affinity Purified. Purified by Protein A affinity chromatography.
form :
Supplied as a liquid in PBS, pH 7.4.
storage stability :
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
tested application :
Western Blot (WB)
app notes :
Suitable for use in Western Blot. Optimal dilutions to be determined by the researcher.
other info1 :
Immunogen: Full length protein corresponding to aa1-296 from human SLAMF7, BC027867, AAH27867).
products categories :
Antibodies; Abs to Matrix Metalloproteinases
products description :
SLAMF7 contains one Ig-like C2-type (immunoglobulin-like) domain. Isoform 1 mediates NK cell activation through a SAP-independent extracellular signal-regulated ERK-mediated pathway. It may play a role in lymphocyte adhesion. Isoform 3 does not mediate any activation. SAP can bind the cytoplasmic tail of isoform 1 when phosphorylated in the presence of Fyn (in vitro). SLAMF7 is expressed in spleen, lymph node, peripheral blood leukocytes, bone marrow, small intestine, stomach, appendix, lung and trachea. Expression was detected in NK cells, activated B-cells, NK-cell line but not in promyelocytic, B-, or T-cell lines. The isoform 3 is expressed at much lower level than isoform 1. There are three named isoforms.
ncbi acc num :
NP_001269522.1
ncbi gb acc num :
NM_001282593.1
ncbi mol weight :
37,421 Da
uniprot summary :
SLAMF7: Isoform 1 mediates NK cell activation through a SH2D1A- independent extracellular signal-regulated ERK-mediated pathway. May play a role in lymphocyte adhesion. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral; Immunoglobulin superfamily. Chromosomal Location of Human Ortholog: 1q23.1-q24.1. Cellular Component: integral to membrane. Molecular Function: receptor activity. Biological Process: natural killer cell mediated cytotoxicity; natural killer cell activation; cell adhesion