product summary
Loading...
company name :
MyBioSource
product type :
antibody
product name :
Utrophin (UTRN, Dystrophin-related Protein 1, DRP1, DRP-1, DMDL, DRP)
catalog :
MBS6008391
quantity :
0.1 mg
price :
580 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
[5G6]
reactivity :
human
application :
enzyme immunoassay
more info or order :
image
image 1 :
MyBioSource MBS6008391 image 1
Detection limit for recombinant GST tagged UTRN is 0.1ng/ml using MBS6008391 as a capture antibody.
image 2 :
MyBioSource MBS6008391 image 2
Immunofluorescence of HeLa celLauren Shoreusing MBS6008391 (10ug/ml).
product information
catalog number :
MBS6008391
products type :
Antibody
products full name :
Utrophin (UTRN, Dystrophin-related Protein 1, DRP1, DRP-1, DMDL, DRP)
products short name :
[Utrophin]
products name syn :
[Anti -Utrophin (UTRN, Dystrophin-related Protein 1, DRP1, DRP-1, DMDL, DRP)]
other names :
[utrophin; Utrophin; utrophin; DRP-1; dystrophin-related protein 1; utrophin; Dystrophin-related protein 1]
other gene names :
[UTRN; UTRN; DRP; DMDL; DRP1; DMDL; DRP1; DRP-1]
uniprot entry name :
UTRO_HUMAN
clonality :
Monoclonal
isotype :
IgG1,k
clone :
[5G6]
host :
Mouse
reactivity :
Human
sequence :
LEARMQILEDHNKQLESQLHRLRQLLEQPESDSRINGVS
PWASPQHSALSYSLDPDASGPQFHQAAGEDLLAPPHDTS
TDLTEVMEQIHSTFPSCCPNVPSRPQAM
specificity :
Recognizes human Utrophin.
purity :
Affinity Purified. Purified by Protein A affinity chromatography.
form :
Supplied as a liquid in PBS, pH 7.4
concentration :
0.5mg/ml
storage stability :
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months after receipt.For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
tested application :
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Other applications not tested.
app notes :
Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Optimal dilutions to be determined by the researcher.
image1 heading :
Testing Data
image2 heading :
Immunofluorescence (IF)
other info1 :
Immunogen: Partial recombinant corresponding to aa3328-3433 from human UTRN (NP_009055) with GST tag. MW of the GST tag alone is 26kD.
other info2 :
Grade: Purified
products categories :
Antibodies; Abs to Neuroscience
products description :
Utrophin is a homologue of dystrophin and in normal muscle utrophin expression is restricted to neuromuscular junctions. Interestingly, in dystrophindeficient muscle, utrophin may be upregulated and is also present around the periphery of most muscle fibers. This antibody will help identify utrophin expression in muscle sections.
ncbi gi num :
110611228
ncbi acc num :
NP_009055.2
ncbi gb acc num :
NM_007124.2
uniprot acc num :
P46939
ncbi summary :
This gene shares both structural and functional similarities with the dystrophin gene. It contains an actin-binding N-terminus, a triple coiled-coil repeat central region, and a C-terminus that consists of protein-protein interaction motifs which interact with dystroglycan protein components. The protein encoded by this gene is located at the neuromuscular synapse and myotendinous junctions, where it participates in post-synaptic membrane maintenance and acetylcholine receptor clustering. Mouse studies suggest that this gene may serve as a functional substitute for the dystrophin gene and therefore, may serve as a potential therapeutic alternative to muscular dystrophy which is caused by mutations in the dystrophin gene. Alternative splicing of the utrophin gene has been described; however, the full-length nature of these variants has not yet been determined. [provided by RefSeq, Jul 2008]
uniprot summary :
utrophin: May play a role in anchoring the cytoskeleton to the plasma membrane. Protein type: Dystrophin complex; Motility/polarity/chemotaxis. Chromosomal Location of Human Ortholog: 6q24. Cellular Component: nucleoplasm; dystrophin-associated glycoprotein complex; filopodium membrane; postsynaptic membrane; protein complex; cytoskeleton; membrane; cytoplasm; plasma membrane; cell junction; neuromuscular junction; filopodium. Molecular Function: integrin binding; protein binding; zinc ion binding; actin binding; protein kinase binding; vinculin binding. Biological Process: muscle development; muscle contraction; positive regulation of cell-matrix adhesion
size1 :
0.1 mg
price1 :
580 USD
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!