catalog number :
MBS6008391
products full name :
Utrophin (UTRN, Dystrophin-related Protein 1, DRP1, DRP-1, DMDL, DRP)
products short name :
[Utrophin]
products name syn :
[Anti -Utrophin (UTRN, Dystrophin-related Protein 1, DRP1, DRP-1, DMDL, DRP)]
other names :
[utrophin; Utrophin; utrophin; DRP-1; dystrophin-related protein 1; utrophin; Dystrophin-related protein 1]
other gene names :
[UTRN; UTRN; DRP; DMDL; DRP1; DMDL; DRP1; DRP-1]
uniprot entry name :
UTRO_HUMAN
sequence :
LEARMQILEDHNKQLESQLHRLRQLLEQPESDSRINGVS
PWASPQHSALSYSLDPDASGPQFHQAAGEDLLAPPHDTS
TDLTEVMEQIHSTFPSCCPNVPSRPQAM
specificity :
Recognizes human Utrophin.
purity :
Affinity Purified. Purified by Protein A affinity chromatography.
form :
Supplied as a liquid in PBS, pH 7.4
storage stability :
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months after receipt.For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
tested application :
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Other applications not tested.
app notes :
Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Optimal dilutions to be determined by the researcher.
image1 heading :
Testing Data
image2 heading :
Immunofluorescence (IF)
other info1 :
Immunogen: Partial recombinant corresponding to aa3328-3433 from human UTRN (NP_009055) with GST tag. MW of the GST tag alone is 26kD.
other info2 :
Grade: Purified
products categories :
Antibodies; Abs to Neuroscience
products description :
Utrophin is a homologue of dystrophin and in normal muscle utrophin expression is restricted to neuromuscular junctions. Interestingly, in dystrophindeficient muscle, utrophin may be upregulated and is also present around the periphery of most muscle fibers. This antibody will help identify utrophin expression in muscle sections.
ncbi acc num :
NP_009055.2
ncbi gb acc num :
NM_007124.2
ncbi summary :
This gene shares both structural and functional similarities with the dystrophin gene. It contains an actin-binding N-terminus, a triple coiled-coil repeat central region, and a C-terminus that consists of protein-protein interaction motifs which interact with dystroglycan protein components. The protein encoded by this gene is located at the neuromuscular synapse and myotendinous junctions, where it participates in post-synaptic membrane maintenance and acetylcholine receptor clustering. Mouse studies suggest that this gene may serve as a functional substitute for the dystrophin gene and therefore, may serve as a potential therapeutic alternative to muscular dystrophy which is caused by mutations in the dystrophin gene. Alternative splicing of the utrophin gene has been described; however, the full-length nature of these variants has not yet been determined. [provided by RefSeq, Jul 2008]
uniprot summary :
utrophin: May play a role in anchoring the cytoskeleton to the plasma membrane. Protein type: Dystrophin complex; Motility/polarity/chemotaxis. Chromosomal Location of Human Ortholog: 6q24. Cellular Component: nucleoplasm; dystrophin-associated glycoprotein complex; filopodium membrane; postsynaptic membrane; protein complex; cytoskeleton; membrane; cytoplasm; plasma membrane; cell junction; neuromuscular junction; filopodium. Molecular Function: integrin binding; protein binding; zinc ion binding; actin binding; protein kinase binding; vinculin binding. Biological Process: muscle development; muscle contraction; positive regulation of cell-matrix adhesion