CIRBP (Cold-inducible RNA-binding Protein, A18 hnRNP, Glycine-rich RNA-binding Protein CIRP, A18HNRNP, CIRP) | MyBioSource MBS6007311 product information

product summary

company name :

MyBioSource

product type :

antibody

product name :

CIRBP (Cold-inducible RNA-binding Protein, A18 hnRNP, Glycine-rich RNA-binding Protein CIRP, A18HNRNP, CIRP)

catalog :

MBS6007311

quantity :

0.1 mg

price :

580 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

[1C9]

reactivity :

human

application :

western blot, ELISA, enzyme immunoassay

more info or order :

MyBioSource product webpage

image

image 1 :

Western Blot detection against Immunogen (35.64kD).

image 2 :

Detection limit for recombinant GST tagged CIRBP is ~0.3ng/ml as a capture antibody.

product information

catalog number :

MBS6007311

products type :

Antibody

products full name :

CIRBP (Cold-inducible RNA-binding Protein, A18 hnRNP, Glycine-rich RNA-binding Protein CIRP, A18HNRNP, CIRP)

products short name :

[CIRBP]

products name syn :

[Anti -CIRBP (Cold-inducible RNA-binding Protein, A18 hnRNP, Glycine-rich RNA-binding Protein CIRP, A18HNRNP, CIRP)]

other names :

[cold-inducible RNA-binding protein; Cold-inducible RNA-binding protein; cold-inducible RNA-binding protein; A18 hnRNP; glycine-rich RNA binding protein; cold inducible RNA-binding protein; glycine-rich RNA-binding protein CIRP; cold inducible RNA binding protein; A18 hnRNP; Glycine-rich RNA-binding protein CIRP]

other gene names :

[CIRBP; CIRBP; CIRP; A18HNRNP; CIRP]

uniprot entry name :

CIRBP_HUMAN

clonality :

Monoclonal

isotype :

IgG2a,k

clone :

[1C9]

host :

Mouse

reactivity :

Human

sequence :

MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVK
DRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIR
VDQAGKSSDNRS

specificity :

Recognizes human CIRBP.

purity :

Affinity Purified. Purified by Protein A affinity chromatography.

form :

Supplied as a liquid in PBS, pH 7.4.

concentration :

1.0mg/ml

storage stability :

May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

tested application :

ELISA (EL/EIA), Western Blot (WB)

app notes :

Suitable for use in ELISA, Immunoflourescence and Western Blot. Other applications not tested.

image1 heading :

Western Blot (WB)

image2 heading :

Testing Data

other info1 :

Immunogen: Partial recombinant corresponding to aa1-90 from human CIRBP (NP_001271.1) with GST tag. MW of the GST tag alone is 26kD.

products categories :

Antibodies; Abs to Binding Proteins

products description :

Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor. Promotes assembly of stress granules (SGs), when overexpressed.

ncbi gi num :

4502847

ncbi acc num :

NP_001271.1

ncbi gb acc num :

NM_001280.2

uniprot acc num :

Q14011

ncbi mol weight :

18,648 Da

uniprot summary :

Function: Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor . By similarity. Promotes assembly of stress granules (SGs), when overexpressed. Ref.5 Ref.7. Subunit structure: Interacts with EIF4G1. Associates with ribosomes. Ref.7. Subcellular location: Nucleus nucleoplasm. Cytoplasm. Note: Translocates from the nucleus to the cytoplasm after exposure to UV radiation. Translocates from the nucleus to the cytoplasm into stress granules upon various cytoplasmic stresses, such as osmotic and heat shocks. Its recruitment into stress granules occurs in the absence of TIAR proteins . By similarity. Ref.5. Tissue specificity: Ubiquitous. Induction: By cold stress in response to DNA damage induced by UV irradiation or UV mimetic agents. Up-regulated by hypoxia. Ref.6. Domain: Both the RRM domain and the arginine, glycine (RGG) rich domain are necessary for binding to the TXN 3'-untranslated region. Both the RRM domain and the arginine, glycine (RGG) rich domain (RGG repeats) are necessary for optimal recruitment into SGs upon cellular stress. The C-terminal domain containing RGG repeats is necessary for translational repression . By similarity. Post-translational modification: Methylated on arginine residues. Methylation of the RGG motifs is a prerequisite for recruitment into SGs . By similarity.Phosphorylated by CK2, GSK3A and GSK3B. Phosphorylation by GSK3B increases RNA-binding activity to the TXN 3'-UTR transcript upon exposure to UV radiation. Ref.7. Sequence similarities: Contains 1 RRM (RNA recognition motif) domain.

size1 :

0.1 mg

price1 :

580 USD

more info or order :

MyBioSource product webpage