FCN2 (Ficolin-2, 37 kDa Elastin-binding Protein, Collagen/Fibrinogen Domain-containing Protein 2, EBP-37, Ficolin-B, Ficolin-beta, Hucolin, L-ficolin, Serum Lectin p35, FCNL) | MyBioSource MBS6005306 product information

product summary

company name :

MyBioSource

product type :

antibody

product name :

FCN2 (Ficolin-2, 37 kDa Elastin-binding Protein, Collagen/Fibrinogen Domain-containing Protein 2, EBP-37, Ficolin-B, Ficolin-beta, Hucolin, L-ficolin, Serum Lectin p35, FCNL)

catalog :

MBS6005306

quantity :

0.1 mg

price :

615 USD

clonality :

polyclonal

host :

rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, other

more info or order :

MyBioSource product webpage

image

image 1 :

Western Blot analysis of FCN2 expression in human colon using MBS6005306.

image 2 :

Western Blot analysis of FCN2 expression in transfected 293T cell line by MBS6005306. Lane 1: FCN2 transfected lysate (34kD). Lane 2: Non-transfected lysate.

product information

catalog number :

MBS6005306

products type :

Antibody

products full name :

FCN2 (Ficolin-2, 37 kDa Elastin-binding Protein, Collagen/Fibrinogen Domain-containing Protein 2, EBP-37, Ficolin-B, Ficolin-beta, Hucolin, L-ficolin, Serum Lectin p35, FCNL)

products short name :

[FCN2]

products name syn :

[Anti -FCN2 (Ficolin-2, 37 kDa Elastin-binding Protein, Collagen/Fibrinogen Domain-containing Protein 2, EBP-37, Ficolin-B, Ficolin-beta, Hucolin, L-ficolin, Serum Lectin p35, FCNL)]

other names :

[ficolin-2 isoform a; Ficolin-2; ficolin-2; L-ficolin; ficolin B; ficolin-B; ficolin-beta; serum lectin p35; 37 kDa elastin-binding protein; collagen/fibrinogen domain-containing protein 2; ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin); ficolin (collagen/fibrinogen domain containing lectin) 2; 37 kDa elastin-binding protein; Collagen/fibrinogen domain-containing protein 2; EBP-37; Ficolin-B; Ficolin-beta; Hucolin; L-ficolin; Serum lectin p35]

other gene names :

[FCN2; FCN2; P35; FCNL; EBP-37; ficolin-2; FCNL]

uniprot entry name :

FCN2_HUMAN

clonality :

Polyclonal

isotype :

IgG

host :

Rabbit

reactivity :

Human

sequence :

MELDRAVGVLGAATLLLSFLGMAWALQAADTCPEVKMVG
LEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPG
PPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSG
WHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFY
RDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDL
VDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDS
LTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVS
NLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRP
A

specificity :

Recognizes human FCN2.

purity :

Purified by Protein A affinity chromatography.

form :

Supplied as a liquid in PBS, pH 7.4.

storage stability :

May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

tested application :

Western Blot (WB) - Other applications not tested.

app notes :

Optimal dilutions to be determined by end user.

image1 heading :

Western Blot (WB)

image2 heading :

Western Blot (WB)

other info1 :

Grade: Affinity Purified. Immunogen: Full length protein corresponding to aa1-313 from human FCN2.

products categories :

Antibodies; Abs to Serum Proteins

products description :

May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc-binding lectin. Enhances phagocytosis of S.typhimurium by neutrophils, suggesting an opsonic effect via the collagen region.

ncbi gi num :

61744445

ncbi acc num :

NP_004099.2

ncbi gb acc num :

NM_004108.2

uniprot acc num :

Q15485

ncbi pathways :

Complement Cascade Pathway (106405); Creation Of C4 And C2 Activators Pathway (106407); Ficolins Bind To Repetitive Carbohydrate Structures On The Target Cell Surface Pathway (833818); Immune System Pathway (106386); Initial Triggering Of Complement Pathway (106406); Innate Immune System Pathway (106387); Lectin Pathway Of Complement Activation (106408)

ncbi summary :

The product of this gene belongs to the ficolin family of proteins. This family is characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. This gene is predominantly expressed in the liver, and has been shown to have carbohydrate binding and opsonic activities. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

uniprot summary :

FCN2: May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc- binding lectin. Enhances phagocytosis of S.typhimurium by neutrophils, suggesting an opsonic effect via the collagen region. Belongs to the ficolin lectin family. 2 isoforms of the human protein are produced by alternative splicing. Chromosomal Location of Human Ortholog: 9q34

size1 :

0.1 mg

price1 :

615 USD

more info or order :

MyBioSource product webpage