catalog number :
MBS6004509
products full name :
ZBTB32 (Zinc Finger and BTB Domain-containing Protein 32, FANCC-interacting Protein, Fanconi Anemia Zinc Finger Protein, FAZF, Testis Zinc Finger Protein, TZFP, Zinc Finger Protein 538, ZNF538)
products short name :
[ZBTB32]
products name syn :
[Anti -ZBTB32 (Zinc Finger and BTB Domain-containing Protein 32, FANCC-interacting Protein, Fanconi Anemia Zinc Finger Protein, FAZF, Testis Zinc Finger Protein, TZFP, Zinc Finger Protein 538, ZNF538)]
other names :
[ZBTB32 protein; Zinc finger and BTB domain-containing protein 32; zinc finger and BTB domain-containing protein 32; repressor of GATA; zinc finger protein 538; FANCC-interacting protein; testis zinc finger protein; fanconi anemia zinc finger protein; zinc finger and BTB domain containing 32; FANCC-interacting protein; Fanconi anemia zinc finger protein; Testis zinc finger protein; Zinc finger protein 538]
other gene names :
[ZBTB32; ZBTB32; Rog; FAXF; FAZF; TZFP; ZNF538; FAZF; TZFP; ZNF538]
uniprot entry name :
ZBT32_HUMAN
sequence :
MSLPPIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQE
FPAHSLVLAGVSQQLGRRGQWALGEGISPSTFAQLLNFV
YGESVELQPGELRPLQEAARALGVQSLEEACWRARGDRA
KKPDPGLKKHQEEPEKPSRNPERELGDPGEKQKPEQVSR
TGGREQEMLHKHSPPRGRPEMAGATQEAQQEQTRSKEKR
LQAPVGQRGADGKHGVLTWLRENPGGSEESLRKLPGPLP
PAGSLQTSVTPRPSWAEAPWLVGGQPALWSILLMPPRYG
IPFYHSTPTTGAWQEVWREQRRTCNLCGS
specificity :
Recognizes human ZBTB32.
purity :
Affinity Purified. Purified by Protein A affinity chromatography.
form :
Supplied as a liquid in PBS, pH 7.4.
concentration :
0.5 mg/ml
storage stability :
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
tested application :
Western Blot (WB), Immunofluorescence (IF).
app notes :
Immunofluorescence: 10ug/ml. Optimal dilutions to be determined by the researcher.
image1 heading :
Western Blot (WB)
image2 heading :
Western Blot (WB)
image3 heading :
Immunofluorescence (IF)
other info1 :
Immunogen: Full length protein corresponding to aa1-302 from human ZBTB32
products categories :
Antibodies; Abs to Fanconi Proteins
ncbi acc num :
AAH17700.1
ncbi mol weight :
52,963 Da
ncbi pathways :
DNA Repair Pathway (105837); Fanconi Anemia Pathway (105895); Regulation Of The Fanconi Anemia Pathway (105896)
uniprot summary :
ZBTB32: DNA-binding protein that binds to the to a 5 - TGTACAGTGT-3 core sequence. May function as a transcriptional transactivator and transcriptional repressor. Probably exerts its repressor effect by preventing GATA3 from binding to DNA. May play a role in regulating the differentiation and activation of helper T-cells. Belongs to the krueppel C2H2-type zinc-finger protein family. Protein type: C2H2-type zinc finger protein; DNA-binding. Chromosomal Location of Human Ortholog: 19q13.1. Cellular Component: nucleoplasm; nuclear chromosome; nucleus. Molecular Function: protein binding; DNA binding; zinc ion binding; transcription corepressor activity. Biological Process: transcription from RNA polymerase II promoter; T cell proliferation; hemopoiesis; negative regulation of transcription from RNA polymerase II promoter; DNA repair; regulation of cytokine production