product summary
Loading...
company name :
MyBioSource
product type :
antibody
product name :
Sideroflexin 3 (Sideroflexin-3, SFXN3, SFX3, BA108L7.2)
catalog :
MBS6003897
quantity :
0.1 mg
price :
580 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
[4A3]
reactivity :
human
application :
western blot, ELISA
more info or order :
MyBioSource product webpage
image
image 1 :
MyBioSource MBS6003897 image 1
Western Blot detection against Immunogen (37kD).
image 2 :
MyBioSource MBS6003897 image 2
Western Blot analysis of SFXN3 expression in Hela NE.
image 3 :
MyBioSource MBS6003897 image 3
Western Blot analysis of SFXN3 expression in transfected 293T cell line by 133247 Lane 1: SFXN3 transfected lysate (35.5kD). Lane 2: Non-transfected lysate.
product information
catalog number :
MBS6003897
products type :
Antibody
products full name :
Sideroflexin 3 (Sideroflexin-3, SFXN3, SFX3, BA108L7.2)
products short name :
[Sideroflexin 3]
products name syn :
[Anti -Sideroflexin 3 (Sideroflexin-3, SFXN3, SFX3, BA108L7.2)]
other names :
[sideroflexin 3; Sideroflexin-3; sideroflexin-3; sideroflexin 3]
other gene names :
[SFXN3; SFXN3; SFX3; BA108L7.2]
uniprot entry name :
SFXN3_HUMAN
clonality :
Monoclonal
isotype :
IgG2b, k
clone :
[4A3]
host :
Mouse
reactivity :
Human
sequence :
MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRN
LLLSGAQLEASRNIVQNYRAGVVTPGITEDQLWRAKYVY
DSAFHPDTGEKVVLIGRMSAQV
specificity :
Recognizes human SFXN3.
purity :
Affinity Purified. Purified by Protein A affinity chromatography.
form :
Supplied as a liquid in PBS, pH 7.4.
concentration :
0.5mg/ml
storage stability :
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
tested application :
ELISA, Western Blot (WB)
app notes :
ELISA: 1ng/ml. Optimal dilutions to be determined by the researcher.
image1 heading :
Western Blot (WB)
image2 heading :
Western Blot (WB)
image3 heading :
Western Blot (WB)
image4 heading :
Testing Data
image4 description :
Detection limit for recombinant GST tagged SFXN3 is 1ng/ml as a capture antibody.
other info1 :
Immunogen: Partial recombinant corresponding to aa1-100 from human SFXN3 (AAH00124) with GST tag. MW of the GST tag alone is 26kD.
products categories :
Antibodies; Abs to Ion Transport
ncbi gi num :
119570172
ncbi acc num :
EAW49787.1
uniprot acc num :
Q9BWM7
ncbi mol weight :
35,979 Da
ncbi pathways :
Validated Targets Of C-MYC Transcriptional Repression Pathway (169353)
uniprot summary :
SFXN3: Potential iron transporter. Belongs to the sideroflexin family. Protein type: Membrane protein, integral; Membrane protein, multi-pass. Chromosomal Location of Human Ortholog: 10q24.31. Cellular Component: mitochondrion; mitochondrial membrane; integral to membrane. Molecular Function: ion transmembrane transporter activity. Biological Process: iron ion homeostasis
size1 :
0.1 mg
price1 :
580 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!