RBMXL2 (RNA-binding Motif Protein, X-linked-like-2, Testis-specific Heterogeneous Nuclear Ribonucleoprotein G-T, hnRNP G-T, HNRNPGT) | MyBioSource MBS6002137 product information

product summary

company name :

MyBioSource

product type :

antibody

product name :

RBMXL2 (RNA-binding Motif Protein, X-linked-like-2, Testis-specific Heterogeneous Nuclear Ribonucleoprotein G-T, hnRNP G-T, HNRNPGT)

catalog :

MBS6002137

quantity :

0.1 mg

price :

580 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

[6F11]

reactivity :

human

application :

enzyme immunoassay

more info or order :

MyBioSource product webpage

image

image 1 :

Western Blot detection against Immunogen (36.01kD) using MBS6002137.

image 2 :

Western Blot analysis of HNRNPG-T expression in HeLa using MBS6002137.

image 3 :

Immunoperoxidase on formalin-fixed paraffin-embedded human testis using MBS6002137 (3ug/ml).

product information

catalog number :

MBS6002137

products type :

Antibody

products full name :

RBMXL2 (RNA-binding Motif Protein, X-linked-like-2, Testis-specific Heterogeneous Nuclear Ribonucleoprotein G-T, hnRNP G-T, HNRNPGT)

products short name :

[RBMXL2]

products name syn :

[Anti -RBMXL2 (RNA-binding Motif Protein, X-linked-like-2, Testis-specific Heterogeneous Nuclear Ribonucleoprotein G-T, hnRNP G-T, HNRNPGT)]

other names :

[RNA-binding motif protein, X-linked-like-2; RNA-binding motif protein, X-linked-like-2; RNA-binding motif protein, X-linked-like-2; hnRNP G-T; heterogeneous nuclear ribonucleoprotein G T; testes specific heterogenous nuclear ribonucleoprotein G T; testes-specific heterogenous nuclear ribonucleoprotein G-T; testis-specific heterogeneous nuclear ribonucleoprotein G-T; RNA binding motif protein, X-linked-like 2; Testis-specific heterogeneous nuclear ribonucleoprotein G-T]

other gene names :

[RBMXL2; RBMXL2; HNRPGT; HNRNPGT; HNRNPG-T; HNRNPGT; hnRNP G-T]

uniprot entry name :

RMXL2_HUMAN

clonality :

Monoclonal

isotype :

IgG1,k

clone :

[6F11]

host :

Mouse

reactivity :

Human

sequence :

MVEADRPGKLFIGGLNLETDEKALEAEFGKYGRIVEVLL
MKDRETNKSRGFAFVTFESPADAKAAARDMNGKSLDGKA
IKVAQATKPAFE*

specificity :

Recognizes human RMBXL2

purity :

Affinity Purified. Purified by Protein A affinity chromatography.

form :

Supplied as a liquid in PBS, pH 7.4

concentration :

0.32 mg/ml

storage stability :

May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

tested application :

Suitable for use in ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). Other applications not tested.

app notes :

Immunohistochemistry (FFPE): 3ug/ml. Immunofluorescence: 10ug/ml. Optimal dilutions to be determined by the researcher.

image1 heading :

Western Blot (WB)

image2 heading :

Western Blot (WB)

image3 heading :

Immunohistochemistry (IHC)

image4 heading :

Immunofluorescence (IF)

image4 description :

Immunofluorescence of HeLa cells using MBS6002137 (10ug/ml).

image5 heading :

Testing Data

image5 description :

Detection limit for recombinant GST tagged HNRNPG-T is ~0.1ng/ml using 127981as a capture antibody.

other info1 :

Immunogen: Partial recombinant corresponding to aa1-90 from human RBMXL2 with GST tag. MW of the GST tag alone is 26kD.

products categories :

Antibodies; Abs to Nuclear Proteins

ncbi gi num :

153252068

ncbi acc num :

NP_014469

ncbi gb acc num :

NM_014469.4

uniprot acc num :

O75526

ncbi pathways :

Spliceosome Pathway (125136); Spliceosome Pathway (124832)

ncbi summary :

This gene belongs to the HNRPG subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two RRM domains that bind RNAs. This gene is intronless and is thought to be derived from a processed retroposon. However, unlike many retroposon-derived genes, this gene is not a pseudogene. The encoded protein has similarity to HNRPG and RBMY proteins and it is suggested to replace HNRPG protein function during meiotic prophase or act as a germ cell-specific splicing regulator. It primarily localizes to the nuclei of meiotic spermatocytes. This gene is a candidate for autosomal male infertility. [provided by RefSeq, Jul 2008]

uniprot summary :

RBMXL2: . Chromosomal Location of Human Ortholog: 11p15. Cellular Component: nucleus; ribonucleoprotein complex. Molecular Function: RNA binding; nucleotide binding

size1 :

0.1 mg

price1 :

580 USD

more info or order :

MyBioSource product webpage