antibody

SIGLEC12 (Sialic Acid-binding Ig-like Lectin 12, Siglec-12, Siglec-XII, S2V, Sialic Acid-binding Ig-like Lectin-like 1, SIGLECL1, Siglec-L1, SLG, UNQ9215/PRO34042)

MBS6001946

0.1 mg

580 USD

monoclonal

mouse

nonconjugated

[1D1]

Antibody

SIGLEC12 (Sialic Acid-binding Ig-like Lectin 12, Siglec-12, Siglec-XII, S2V, Sialic Acid-binding Ig-like Lectin-like 1, SIGLECL1, Siglec-L1, SLG, UNQ9215/PRO34042)

[SIGLEC12]

[Anti -SIGLEC12 (Sialic Acid-binding Ig-like Lectin 12, Siglec-12, Siglec-XII, S2V, Sialic Acid-binding Ig-like Lectin-like 1, SIGLECL1, Siglec-L1, SLG, UNQ9215/PRO34042)]

[sialic acid-binding Ig-like lectin 12 isoform a; Sialic acid-binding Ig-like lectin 12; sialic acid-binding Ig-like lectin 12; SIGLEC-like 1; sialic acid-binding Ig-like lectin-like 1; sialic acid binding Ig-like lectin 12 (gene/pseudogene); Sialic acid-binding Ig-like lectin-like 1]

[SIGLEC12; SIGLEC12; S2V; SLG; SIGLECL1; Siglec-XII; SIGLECL1; SLG; Siglec-12; Siglec-L1]

SIG12_HUMAN

Monoclonal

IgG2a,k

[1D1]

Mouse

RSCRKKSARPAVGVGDTGMEDANAVRGSASQGPLIESPA
DDSPPHHAPPALATPSPEEGEIQYASLSFHKARPQYPQE
QEAIGYEYSEINIPK

Recognizes human SIGLEC12.

Affinity Purified. Purified by Protein A affinity chromatography.

Supplied as a liquid in PBS, pH 7.4

1mg/ml

May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

ELISA (EL/EIA), Western Blot (WB). Other applications not tested.

Optimal dilutions to be determined by the researcher.

Western Blot (WB)

Testing Data

Immunogen: Partial recombinant protein corresponding to aa503-595 fromhuman SIGLEC12 with GST tag. MW of the GST tag alone is 26kD

Antibodies; Abs to Lectins

Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging to the immunoglobulin superfamily. They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on glycolipids and glycoproteins. This gene encodes a member of the SIGLEC3-like subfamily of SIGLECs. Members of this subfamily are characterized by an extracellular V-set immunoglobulin-like domain followed by two C2-set immunoglobulin-like domains, and the cytoplasmic tyrosine-based motifs ITIM and SLAM-like. The encoded protein, upon tyrosine phosphorylation, has been shown to recruit the Src homology 2 domain-containing protein-tyrosine phosphatases SHP1 and SHP2. It has been suggested that the protein is involved in the negative regulation of macrophage signaling by functioning as an inhibitory receptor.

16506828

NP_053003.1

NM_053003.3

Q96PQ1

Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging to the immunoglobulin superfamily. They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on glycolipids and glycoproteins. This gene encodes a member of the SIGLEC3-like subfamily of SIGLECs. Members of this subfamily are characterized by an extracellular V-set immunoglobulin-like domain followed by two C2-set immunoglobulin-like domains, and the cytoplasmic tyrosine-based motifs ITIM and SLAM-like. The encoded protein, upon tyrosine phosphorylation, has been shown to recruit the Src homology 2 domain-containing protein-tyrosine phosphatases SHP1 and SHP2. It has been suggested that the protein is involved in the negative regulation of macrophage signaling by functioning as an inhibitory receptor. This gene is located in a cluster with other SIGLEC3-like genes on 19q13.4. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]

SIGLEC12: Putative adhesion molecule that mediates sialic-acid dependent binding to cells. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral; Cell surface. Chromosomal Location of Human Ortholog: 19q13.4. Cellular Component: integral to membrane. Molecular Function: carbohydrate binding. Biological Process: cell adhesion

0.1 mg

580 USD