product summary
Loading...
company name :
MyBioSource
product type :
antibody
product name :
ATCAY (Caytaxin, Ataxia Cayman Type Protein, BNIP-2-homolgy, BNIP-H, KIAA1872)
catalog :
MBS6001808
quantity :
0.1 mg
price :
580 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
[4F2]
reactivity :
human, cow
application :
western blot, ELISA
more info or order :
MyBioSource product webpage
image
image 1 :
MyBioSource MBS6001808 image 1
Western Blot detection against Immunogen using MBS6001808 (33.37kD).
image 2 :
MyBioSource MBS6001808 image 2
Western Blot analysis of ATCAY expression in IMR-32 using MBS6001808 .
image 3 :
MyBioSource MBS6001808 image 3
Detection limit for recombinant GST tagged ATCAY is 0.03ng/ml using MBS6001808 as a capture antibody.
product information
catalog number :
MBS6001808
products type :
Antibody
products full name :
ATCAY (Caytaxin, Ataxia Cayman Type Protein, BNIP-2-homolgy, BNIP-H, KIAA1872)
products short name :
[ATCAY]
products name syn :
[Anti -ATCAY (Caytaxin, Ataxia Cayman Type Protein, BNIP-2-homolgy, BNIP-H, KIAA1872)]
other names :
[ATCAY protein; caytaxin; ataxia, cerebellar, Cayman type (caytaxin); ataxia, cerebellar, Cayman type<]
other gene names :
[ATCAY; caytaxin]
clonality :
Monoclonal
isotype :
IgG1,k
clone :
[4F2]
host :
Mouse
reactivity :
Human
sequence :
TTEATLRMENVDVKEEWQDEDLPRPLPEETGVELLGSPV
EDTSSPPNTLNFNGAHRKRKTLVAPEI
specificity :
Recognizes human ATCAY.
purity :
Affinity Purified. Purified by Protein A affinity chromatography.
form :
Supplied as a liquid in PBS, pH 7.2.
concentration :
1 mg/mL
storage stability :
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
tested application :
Suitable for use in ELISA and Western Blot.
app notes :
Other applications not tested
image1 heading :
Western Blot (WB)
image2 heading :
Western Blot (WB)
image3 heading :
Testing Data
other info1 :
Immunogen: Partial recombinant corresponding to aa3-69 from human ATCAY (NP_149053) with GST tag. MW of the GST tag alone is 26kD.
products categories :
Antibodies; Abs to Neuroscience
ncbi gi num :
126010705
ncbi acc num :
AAI33610.1
size1 :
0.1 mg
price1 :
580 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!