catalog number :
MBS6001798
products full name :
SLC20A1 (Sodium-dependent Phosphate Transporter 1, Solute Carrier Family 20 Member 1, Phosphate Transporter 1, PiT-1, Gibbon Ape Leukemia Virus Receptor 1, GLVR-1, Leukemia Virus Receptor 1 Homolog, GLVR1, PIT1, DKFZp686J2397, FLJ41426)
products short name :
[SLC20A1]
other names :
[sodium-dependent phosphate transporter 1; Sodium-dependent phosphate transporter 1; sodium-dependent phosphate transporter 1; leukemia virus receptor 1 homolog; solute carrier family 20 member 1; gibbon ape leukemia virus receptor 1; solute carrier family 20 (phosphate transporter), member 1; Gibbon ape leukemia virus receptor 1; GLVR-1; Leukemia virus receptor 1 homolog; Phosphate transporter 1; PiT-1; Solute carrier family 20 member 1]
other gene names :
[SLC20A1; SLC20A1; PIT1; GLVR1; PiT-1; Glvr-1; GLVR1; PIT1; GLVR-1; PiT-1]
uniprot entry name :
S20A1_HUMAN
sequence :
MATLITSTTAATAASGPLVDYLWMLILGFIIAFVLAFSV
GANDVANSFGTAVGSGVVTLKQACILASIFETVGSVLLG
AKVSETIRKGLIDVEMYNSTQGLLMAGSVSAMFGSAVWQ
LVASFLKLPISGTHCIVGATIGFSLVAKGQEGVKWSELI
KIVMSWFVSPLLSGIMSGILFFLVRAFILHKADPVPNGL
RALPVFYACTVGINLFSIMYTGAPLLGFDKLPLWGTILI
SVGCAVFCALIVWFFVCPRMKRKIEREIKCSPSESPLME
KKNSLKEDHEETKLSVGDIENKHPVSEVGPATVPLQAVV
EERTVSFKLGDLEEAPERERLPSVDLKEETSIDSTVNGA
VQLPNGNLVQFSQAVSNQINSSGHYQYHTVHKDSGLYKE
LLHKLHLAKVGDCMGDSGDKPLRRNNSYTSYTMAICGMP
LDSFRAKEGEQKGEEMEKLTWPNADSKKRIRMDSYTSYC
NAVSDLHSASEIDMSVKAEMGLGDRKGSNGSLEEWYDQD
KPEVSLLFQFLQILTACFGSFAHGGNDVSNAIGPLVALY
LVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQ
TMGKDLTPITPSSGFSIELASALTVVIASNIGLPISTTH
CKVGSVVSVGWLRSKKAVDWRLFRNIFMAWFVTVPISGV
ISAAIMAIFRYVILRM
specificity :
Recognizes human SLC20A1.
purity :
Purified by Protein A affinity chromatography.
form :
Supplied as a liquid in PBS, pH 7.4.
concentration :
0.5 mg/ml
storage stability :
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
tested application :
Western Blot (WB)
app notes :
Optimal dilutions to be determined by the researcher.
image1 heading :
Western Blot (WB)
other info1 :
Grade: Affinity Purified. Immunogen: Full length protein corresponding to aa1-679 of human SLC20A1.
products categories :
Antibodies; Abs to Ion Channel
products description :
Retrovirus receptors allow infection of human and murine cells by various retroviruses. The receptors that have been identified at the molecular level include CD4 (MIM 186940) for human immunodeficiency virus, Rec1 for murine ecotropic virus, and GLVR1 for gibbon ape leukemia virus (see MIM 182090). These 3 proteins show no homology to one another at the DNA or protein level. GLVR1 is a sodium-dependent phosphate symporter.[supplied by OMIM]
ncbi acc num :
NP_005406.3
ncbi gb acc num :
NM_005415.4
ncbi pathways :
SLC-mediated Transmembrane Transport Pathway (119558); Sodium-coupled Phosphate Cotransporters Pathway (119565); Transmembrane Transport Of Small Molecules Pathway (106572); Transport Of Inorganic Cations/anions And Amino Acids/oligopeptides Pathway (119559)
ncbi summary :
The protein encoded by this gene is a sodium-phosphate symporter that absorbs phosphate from interstitial fluid for use in cellular functions such as metabolism, signal transduction, and nucleic acid and lipid synthesis. The encoded protein is also a retroviral receptor, causing human cells to be susceptible to infection by gibbon ape leukemia virus, simian sarcoma-associated virus, feline leukemia virus subgroup B, and 10A1 murine leukemia virus.[provided by RefSeq, Mar 2011]
uniprot summary :
SLC20A1: Sodium-phosphate symporter which plays a fundamental housekeeping role in phosphate transport, such as absorbing phosphate from interstitial fluid for normal cellular functions such as cellular metabolism, signal transduction, and nucleic acid and lipid synthesis. May play a role in extracellular matrix and cartilage calcification as well as in vascular calcification. May function as a retroviral receptor as it confers human cells susceptibility to infection to Gibbon Ape Leukemia Virus (GaLV), Simian sarcoma-associated virus (SSAV) and Feline leukemia virus subgroup B (FeLV-B) as well as 10A1 murine leukemia virus (10A1 MLV). Belongs to the inorganic phosphate transporter (PiT) (TC 2.A.20) family. Protein type: Membrane protein, multi-pass; Transporter, SLC family; Membrane protein, integral; Transporter. Chromosomal Location of Human Ortholog: 2q13. Cellular Component: membrane; integral to plasma membrane; plasma membrane. Molecular Function: signal transducer activity; high affinity inorganic phosphate:sodium symporter activity; receptor activity; sodium:phosphate symporter activity; inorganic phosphate transmembrane transporter activity. Biological Process: positive regulation of I-kappaB kinase/NF-kappaB cascade; transport; ion transport; signal transduction; phosphate metabolic process; transmembrane transport