product summary
Loading...
company name :
MyBioSource
product type :
antibody
product name :
CD5L (CD5 Antigen-like, CT-2, IgM-associated Peptide, SP-alpha, API6, UNQ203/PRO229)
catalog :
MBS6000163
quantity :
0.1 mg
price :
580 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
[1C8]
application :
western blot, ELISA, immunoprecipitation, enzyme immunoassay
more info or order :
MyBioSource product webpage
image
image 1 :
MyBioSource MBS6000163 image 1
Western Blot detection against Immunogen (36.63kD).
image 2 :
MyBioSource MBS6000163 image 2
Western Blot analysis of CD5L expression in HL-60 using MBS6000163.
image 3 :
MyBioSource MBS6000163 image 3
CD5L monoclonal antibody. Western Blot analysis of CD5L expression in different cell lines.
product information
catalog number :
MBS6000163
products type :
Antibody
products full name :
CD5L (CD5 Antigen-like, CT-2, IgM-associated Peptide, SP-alpha, API6, UNQ203/PRO229)
products short name :
[CD5L]
products name syn :
[Anti -CD5L (CD5 Antigen-like, CT-2, IgM-associated Peptide, SP-alpha, API6, UNQ203/PRO229)]
other names :
[CD5L]
clonality :
Monoclonal
isotype :
IgG2a,k
clone :
[1C8]
host :
Mouse
reactivity :
Human
sequence :
QKGQWGTVCDDGWDIKDVAVLCRELGCGAASGTPSGILY
EPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDCSHDE
DAGASCENPESSFSPVPEGVRL
specificity :
Recognizes human CD5L.
purity :
Affinity Purified. Purified by Protein A affinity chromatography.
form :
Supplied as a liquid in PBS, pH 7.2.
storage stability :
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
tested application :
ELISA (EL/EIA), Western Blot (WB), Immunoprecipitation (IP)
app notes :
Suitable for use in ELISA, Western Blot and Immunoprecipitation.
image1 heading :
Western Blot (WB)
image2 heading :
Western Blot (WB)
image3 heading :
Western Blot (WB)
image4 heading :
Immunoprecipitation (IP)
image4 description :
Immunoprecipitation of CD5L transfected lysate using MBS6000163 and Protein A Magnetic Bead and immunoblotted with CD5L rabbit polyclonal antibody.
image5 heading :
Testing Data
image5 description :
Detection limit for recombinant GST tagged CD5L is ~0.3ng/ml as a capture antibody.
other info1 :
Immunogen: Partial recombinant corresponding to aa41-140 from human CD5L (AAH33586) with GST tag. MW of the GST tag alone is 26kD.
products categories :
Antibodies; Abs to CD Markers
products description :
CD5L is a member of the scavenger receptor cysteine-rich domain superfamily (SRCR-SF) initially identified as an inducible cell surface ligand of CD5. It was shown that CD5L functions in the thymus as the inducer of resistance to apoptosis within CD4+/CD8+ thymocytes and as the supporter of the viability of these cells before thymic selection. CD5L was also shown to support macrophage survival and enhance their phagocytic function. More recent experiments using recombinant CD5L significantly inhibited apoptosis of NKT and T cells obtained from C. parvum-stimulated livers in vitro, suggesting that CD5L functions to induce resistance to apoptosis in these cells and supports host defense against inflammation during infection.
ncbi gi num :
37182111
ncbi acc num :
AAQ88858.1
uniprot summary :
CD5L: May play a role in the regulation of the immune system. Seems to play a role as an inhibitor of apoptosis. Protein type: Secreted, signal peptide; Receptor, misc.; Secreted. Chromosomal Location of Human Ortholog: 1q23.1. Cellular Component: extracellular space; membrane; extracellular region. Molecular Function: scavenger receptor activity. Biological Process: receptor-mediated endocytosis; apoptosis; cellular defense response
size1 :
0.1 mg
price1 :
580 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!