product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant HPV 16 E6 envelope protein, HPV 16 E6 full length protein.
catalog :
MBS596032
quantity :
1 mg
price :
390 USD
more info or order :
image
image 1 :
MyBioSource MBS596032 image 1
product information
catalog number :
MBS596032
products type :
Recombinant Protein
products full name :
Recombinant HPV 16 E6 envelope protein, HPV 16 E6 full length protein.
products short name :
[HPV 16 E6]
products name syn :
[Recombinant human papillomavirus 16 E6 protein]
products gene name :
[HPV 16 E6]
host :
E Coli
sequence :
MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVY
CKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYS
KISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPL
CPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRET
QL
purity :
The recombinant HPV 16 E6 has 95% purity as determined by 10% PAGE (coomassie blue staining).
form :
PBS with 4M urea
concentration :
0.96mglml
storage stability :
Storage: Upon arrival, Store at -20 °C. Stability: Five years frozen. One month in solution at room temperature.
tested application :
Immunoassay (IA)
image1 heading :
Test Data
other info1 :
. Important note: centrifuge before opening to ensure complete recovery of vial contents.
other info2 :
Tag: His tag
products description :
More than 100 different human papillomaviruses cause proliferative diseases, many of which are malignant, sllch as cervical cancer. HPV -16 E6 is considered as the major viral oncoproteins involved in cervical cancer. The full length 159 amino acids of HPV16 E6 was expressed from E. coli, the expressed HPV E6 contains 6 x His tag at its C-terminal. The expressed protein HPV 16 E6 with additional vector sequence migrated at 21kDa on 10% SDS-PAGE.
ncbi mol weight :
18 kDa
size1 :
1 mg
price1 :
390 USD
size2 :
2 mg
price2 :
685
size3 :
5 mg
price3 :
1570
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!