product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Transforming Growth Factor-Beta 2, Recombinant Protein
catalog :
MBS555435
quantity :
0.001 mg
price :
200 USD
more info or order :
product information
catalog number :
MBS555435
products type :
Recombinant Protein
products full name :
Transforming Growth Factor-Beta 2, Recombinant Protein
products short name :
[Transforming Growth Factor-Beta 2]
other names :
[TGF beta2, partial; Transforming growth factor beta-2; transforming growth factor beta-2; transforming growth factor, beta 2]
products gene name :
[TGF Beta2]
other gene names :
[TGFB2; TGFB2; TGF-beta-2; TGF-beta-2; LAP]
uniprot entry name :
TGFB2_CHICK
host :
Nicotiana benthamiana
sequence :
EPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASAS PCCVSQDLEPLTI LYYIGKTPKIEQLSNMIVKSCKCS
HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWI
H
HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWI
H
purity :
Greater than 97.0% as determined bySDS-PAGE.
form :
Lyophilized from a concentrated (1mg/ml) solution containing 50mM Tris-HCl pH-7.4.
storage stability :
Lyophilized TGFB2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TGFB2 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
other info1 :
Biological Activity: The biological activity of TGFB2 is measured in culture by its ability to inhibit the mink lung epithelial (Mv1Lu) cells proliferation. ED 50 < 40ng/ml, corresponding to a specific activity of 25,000 units/mg. Reconstitution: It is recommended to reconstitute the lyophilized TGFB2 in sterile 18M?-cm H2O not less than 1ug/40ul, which can then be further diluted to other aqueous solutions.
products categories :
Proteins; Growth/Differentiation Factors and Small Molecules; Stem Cell Research Proteins; Transforming Growth Factors (TGFs); TGF Beta2
products description :
TGFB2 Human Recombinant produced in plants is a homodimeric polypeptide chain containing 2 x 118 amino acids and having a total molecular mass of 27.08kDa. The TGFB2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques.
ncbi gi num :
198443945
ncbi acc num :
ACH88155.1
ncbi pathways :
AGE-RAGE Signaling Pathway In Diabetic Complications (1319972); AGE-RAGE Signaling Pathway In Diabetic Complications (1319775); Cell Cycle Pathway (83960); Cell Cycle Pathway (463); Cytokine-cytokine Receptor Interaction Pathway (119307); Cytokine-cytokine Receptor Interaction Pathway (460); Endocytosis Pathway (102290); Endocytosis Pathway (102181); FoxO Signaling Pathway (921354); MAPK Signaling Pathway (199082)
uniprot summary :
TGF-beta 2 has suppressive effects on interleukin-2 dependent T-cell growth.
size1 :
0.001 mg
price1 :
200 USD
size2 :
0.005 mg
price2 :
295
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!