catalog number :
MBS546162
products full name :
Recombinant Human IGF-BP3 (rHu IGF-BP3)
products short name :
[IGF-BP3]
products name syn :
[human IGF-BP3; Human Insulin-like Growth Factor-Binding Protein 3(rHuIGF-BP3)]
other names :
[insulin-like growth factor-binding protein 3; Insulin-like growth factor-binding protein 3; insulin-like growth factor-binding protein 3; IBP-3; IGFBP-3; IGF-binding protein 3; insulin-like growth factor-binding protein (IGF-BP3); insulin-like growth factor binding protein 3]
products gene name :
[IGF-BP3]
other gene names :
[Igfbp3; Igfbp3; IGF-BP3; Igfbp-3; IBP-3; IGF-binding protein 3; IGFBP-3]
uniprot entry name :
IBP3_RAT
sequence :
PPAPGNASESEEDRSAGEVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYS MQSK
GASSGGLGPVVRCEPCDARALAQCAPPPAVCAELVREPG
CGCCLTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQ
ALLDGRGLCVNASAVSRLRAYLLPA
purity :
>98% by SDS-PAGE and HPLC analyses.
form :
Lyophilized from a 0.2um filtered concentrated solution in PBS, pH 7.4.
storage stability :
This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
other info1 :
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Endotoxin Level: Less than 1EU/ug of rHuIGF-BP3 as determined by LAL method. Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20°C. Further dilutions should be made in appropriate buffered solutions.
other info2 :
Biological Activity: The ED 50 was determined by its ability to inhibit IGF-II induced proliferation of MCF-7. The expected ED 50 for this effect is 0.2 ug/ml in presence of 15 ng/ml of human IGF-II.
products description :
IGF-BP3 is a 30 kDa cysteine-rich secreted protein. It is the major IGF binding protein present in the plasma of human and animals and it is also found in á-granules of platelets. In addition to its ability to modulate the activity of IGF-I and IGF-II, IGF-BP3 exerts inhibitory effects on follicle stimulating hormone (FSH) activity. Decreased plasma levels of IGF-BP3 often results in dwarfism, whereas elevated levels of IGF-BP3 may lead to acromegaly. The expression of IGF-BP3 in fibroblasts is stimulated by mitogenic growth factors such as Bombesin, Vasopressin, PDGF, and EGF.
ncbi acc num :
NP_036720.2
ncbi gb acc num :
NM_012588.2
ncbi mol weight :
28.8 kDa protein consisting of 264 amino acids residues.
ncbi pathways :
Metabolism Of Proteins Pathway (828604); Myometrial Relaxation And Contraction Pathways (198465); Regulation Of Insulin-like Growth Factor (IGF) Transport And Uptake By Insulin-like Growth Factor Binding Proteins (IGFBPs) Pathway (828660); Transcriptional Misregulation In Cancer Pathway (523027); Transcriptional Misregulation In Cancer Pathway (522987); P53 Pathway (219776); P53 Signal Pathway (198463); P53 Signaling Pathway (83447); P53 Signaling Pathway (465)
ncbi summary :
an insulin growth factor (Igf) binding protein; involved in modulating IGF-I action [RGD, Feb 2006]
uniprot summary :
IGFBP3: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Also exhibits IGF-independent antiproliferative and apoptotic effects mediated by its receptor TMEM219/IGFBP-3R. Protein type: Secreted, signal peptide; Secreted; Cell development/differentiation. Cellular Component: extracellular space; nucleus. Molecular Function: insulin-like growth factor binding; protein binding; insulin-like growth factor I binding; fibronectin binding; insulin-like growth factor II binding; protein tyrosine phosphatase activator activity. Biological Process: positive regulation of catalytic activity; positive regulation of insulin-like growth factor receptor signaling pathway; osteoblast differentiation; negative regulation of cell proliferation; regulation of insulin-like growth factor receptor signaling pathway; negative regulation of protein amino acid phosphorylation; positive regulation of MAPKKK cascade; negative regulation of smooth muscle cell proliferation; positive regulation of apoptosis; regulation of growth; negative regulation of smooth muscle cell migration; regulation of cell growth; protein amino acid phosphorylation; positive regulation of myoblast differentiation