product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Hepatitis B Surface Antigen preS1 (rHBsAg-preS1)
catalog :
MBS546028
quantity :
0.01 mg
price :
165 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS546028
products type :
Protein
products full name :
Recombinant Hepatitis B Surface Antigen preS1 (rHBsAg-preS1)
products short name :
[Hepatitis B Surface Antigen preS1]
products name syn :
[Hepatitis B Surface Antigen preS1; rHBsAg-preS1; Hepatitis B Surface Antigen preS1]
host :
E Coli
sequence :
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSN
NPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWS
PQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHP
QA
purity :
>95% by SDS-PAGE and HPLC analyses.
form :
Lyophilized from a 0.2um filtered concentrated (1mg/ml) soluditon in 20mM PB, pH7.4, 50mM NaCl. Physical Appearance: Sterile Filtered White lyohplized (freeze-dried) powder.
storage stability :
This lyophilized preparation is stable at 2-8 degree C, but should be kept at -20 degree C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 degree C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70 degree C. Avoid repeated freeze/thaw cycles.
tested application :
1. Immunochromatography (capture and conjugate). 2. Preparing monoclonal or polyclonal antibodies for HBsAg-preS1. 3. ELISA
other info1 :
Molecular Weight Information: Approximately 12.3 kDa, a single non-glycosylated polypeptide chain containing 111 amino acids
other info2 :
Endotoxin Level: Less than 1EU/mg of rHBsAg-preS1 as determined by LAL method. Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20 degree C. Further dilutions should be made in appropriate buffered solutions.
products description :
Hepatitis B virus (HBV) is a human pathogen, causing serious liver disease. The HBV surface protein antigens (HBsAg) are comprised of three carboxyl co terminal HBs proteins termed large (LHBs), middle (MHBs) and small (SHBs, also called major) protein. LHBs and MHBs also share the highly hydrophobic, repetitive, membrane spanning S domain. In addition, LHBs has a 119 amino acid region called preS1.
ncbi mol weight :
12.6kDa, a single non-glycoslated polypeptide chain containing 119 amino acids.
size1 :
0.01 mg
price1 :
165 USD
size2 :
0.05 mg
price2 :
205
size3 :
1 mg
price3 :
1635
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!